The URL can be used to link to this page

Home My WebLink AboutC-20-16 Cake RedactedCalifornia Secretary of State Electronic Certified Copy I, ALEX PADILLA, Secretary of State of the State of California, hereby certify that the attached transcript of 1 page is a full, true and correct copy of the original record in the custody of the California Secretary of State’s office. IN WITNESS WHEREOF, I execute this certificate and affix the Great Seal of the State of California on this day of ALEX PADILLA Secretary of State Verification Number: Entity (File) Number: To verify the issuance of this Certificate, use the Verification Number above with the Secretary of State Electronic Verification Search available at bizfile.sos.ca.gov UQNTWR 202028810956 October 14, 2020 California Secretary of State Electronic Filing LLC Registration – Articles of Organization Entity Name: Entity (File) Number: File Date: Entity Type: Domestic LLC Jurisdiction: California Detailed Filing Information 1.Entity Name: 2.Business Addresses: a.Initial Street Address of Designated Office in California: b.Initial Mailing Address: 3.Agent for Service of Process: 4.Management Structure: 5.Purpose Statement:The purpose of the limited liability company is to engage in any lawful act or activity for which a limited liability company may be organized under the California Revised Uniform Limited Liability Company Act. Electronic Signature: The organizer affirms the information contained herein is true and correct. Organizer: Certificate Verification Number:Use bizfile.sos.ca.gov to verify the certified copy.Use bizfile.sos.ca.gov for online filings, searches, business records, and resources. COMMUNITY VETERANS OF FRESNO, LLC 202028810956 10/12/2020 COMMUNITY VETERANS OF FRESNO, LLC 3400 COTTAGE WAY, STE G2 #3847 SACRAMENTO , California 95825 United States 3400 COTTAGE WAY, STE G2 #3847 SACRAMENTO , California 95825 United States LEGALINC REGISTERED AGENTS, INC. (C4249296) One Manager UQNTWRLOVETTE DOBSON Final 1 OPTION TO PURCHASE REAL ESTATE This Option to Purchase Real Estate (this “Agreement”) in entered into on November 13, 2020 (the “Effective Date”), by and between Young Kim & Mija Kim (“Optionor”), on one hand, and COMMUNITY VETERANS OF FRESNO, LLC d/b/a CAKE, a limited liability company duly incorporated in the state of California (“Optionee”). A. Optionor are owners of a retail building and land, consisting of a total of approximately 2,501 square feet of built space and additional vacant land, located at 3034, 3064, 3068 and 3094 E. McKinley Avenue, Fresno, California 93730 (the “Property”). B. Optionor desires to grant an option to Optionee (the “Option”) to purchase the Property (the “Transaction”) on the terms described in this Agreement, which Optionee shall be entitled to exercise in accordance with the terms and conditions herein. The right to execute the Option is at the full discretion of Optionee as set forth in this Agreement. NOW, THEREFORE, in consideration of the mutual promises and agreements hereinafter set forth and for other good and valuable consideration, the receipt and sufficiency of which are hereby acknowledged, the parties hereto, intending to be legally bound, hereby agree as follows: 1. Grant of Option; Conditions of Exercise. Optionor hereby grants to Optionee an option to purchase the Property from Optionor in accordance with the terms and conditions set forth herein. Optionee shall be entitled to exercise the Option by giving written notice prior to the Option Expiration Date (as defined below) . a) Exercise of Option and Timeliness. Subject to the receipt of the Option Payment by Optionor, Optionee shall have the right to exercise the Option by delivering to Optionor written notice (the “Option Notice”) at any time on or after the Effective Date and before the 6-month anniversary of the Effective Date (the “Option Expiration Date”). The Option Notice shall specify the anticipated date of closing of the Transaction (the “Closing”), provided, however, that the date of the Closing shall be no more than thirty (30) days after the date of the Option Notice. b) Extension. Optionee may extend the Option Expiration Date in two (2), three (3)-month extensions (each such extension, an “Option Extension”), for up to six (6) additional months, upon paying to Optionor an extension payment of $5,000 for each such Option Extension at least five (5) business days before the expiration of the then applicable Option Expiration Date. Any extension of the Option Expiration Date thereafter shall only be pursuant to a separate mutual agreement between the parties. Final 2 c) Entitlements. Optionee shall obtain all permits, determinations, and approvals necessary to operate Optionee’s proposed business at the Property in accordance with the BCC compliant sales of cannabis products with a Type-10 license (collectively, the “Entitlements”), including, but not limited to, (i) a conditional use permit and development agreement duly issued by the City of Fresno (the “CUP”) and (ii) all licenses required by the Bureau of Cannabis Control of the State of California. Optionee shall be solely responsible for obtaining the Entitlements and shall be solely responsible for all related costs and expenses. Notwithstanding the foregoing, Optionor shall respond to reasonable requests from Optionee as necessitated by Optionee’s efforts to obtain the Entitlements, including the execution by Optionor of related applications, permits, and similar documents, provided that (i) there is no out-of-pocket cost to Optionor and Optionee shall reimburse Optionor for any expenses incurred, (ii) Optionee shall reasonable efforts to minimize disruption to the Optionor, and (iii) any such requests shall not cause interference with Optionor’s business operations. d) Ability to Lease. Optionee acknowledges that Optionor will continue to lease and operate the Property without limitation until the Optionee provides the Option Notice as set forth herein, at which point the parties shall mutually discuss and agree on any necessary modifications to the operation of the Property. e) Consideration for Option. In consideration for the Option granted herein, Optionee will, simultaneous with the execution hereof, make a non-refundable payment of $5,000.00 to Optionor (the “Option Payment”) via check payable to Young Kim to be sent to the address set forth in Section 5 herein, provided, in the event the Optionee exercises the Option by delivering the Option Notice, the Option Payment shall be credited towards the Purchase Price. f) On-Site Security. Upon providing the Option Notice, Optionee shall provide on-site security services at the Property at Optionee’s sole expense. 2. Termination of Option. Optionees’ right to exercise the Option shall terminate at 11:59 p.m. on the date that is the first to occur of the following dates (the “Option Termination Date”): a) the Option Expiration Date, as may be extended, if Optionee has not exercised the Option. b) the date on which Optionee delivers written notice to Optionor that Optionee is electing to terminate this Agreement, effective immediately, on the grounds that Optionee has been unable to obtain, or have determined, in their sole and absolute discretion, that they are unlikely to obtain, the Entitlements. Final 3 c) Any cultivation, manufacturing, or sale of cannabis or any cannabis product shall be deemed a material breach of the Option, and grounds for immediate termination of the Option, if after a cure period of fifteen (15) business days of Optionee’s notice to Optionor, such breach is not cured. 3. Purchase Price and Terms of the Transaction. a) The purchase price of the Property shall be $470,000 (the “Purchase Price”). Upon the delivery of the Option Notice, Optionee shall prepare a separate real estate purchase agreement (the “Purchase Agreement”), which shall be mutually negotiated and executed to effectuate the Closing. The Purchase Price shall be binding on the parties and shall be payable by Optionee to Optionor at the Closing in accordance with the terms and conditions of the Purchase Agreement. The Purchase Agreement shall specify, among other things, that (i) the Property shall be sold by Optionor to Optionee in “as-is,” “where-is” condition, and (ii) Optionor shall re-key the Property prior to its delivery to Optionee. b) Capacity to Sign. All parties represent that they possess all necessary capacity and authority to sign and enter into this Agreement. All individuals signing this Agreement on behalf of a corporation, a partnership, or other legal entity, or signing under a power of attorney or as a trustee, guardian, conservator, or in any legal capacity, represent that they have the necessary capacity and authority to act for, sign, and bind the respective entity or principal on whose behalf they are signing. 4. Miscellaneous. a) Counterpart Copies. This Agreement may be signed in counterpart, and any signed counterpart shall be equivalent to a signed original for all purposes. b) Additional Action. Each of the parties, without further consideration, agrees to execute and deliver such other documents and to take such other action as may be reasonably necessary or appropriate to give full force and effect to the basic terms and intent of this Agreement. c) Entire Agreement. This Agreement contains all of the representations and the entire understanding and agreement of the parties with regard to the subject matter hereof. d) Construction. This Agreement is the result of a full and fair negotiation between the parties and shall not be construed in favor of or against any party. Final 4 e) Gender and Number. As used in this Agreement, the masculine, feminine, or neuter gender, and the singular or plural number, shall include the others whenever the context indicates. f) Headings. The titles and headings of the various sections of this Agreement are intended solely for the convenience of reference and are not intended to explain, modify, or place any construction on any of the provisions of this Agreement. g) Cross-References. All cross-references in this Agreement, unless specifically directed to another agreement or document, refer to provisions within this Agreement. h) Amendments. This Agreement may not be altered or modified except by a writing signed by all of the parties. i) Successors and Assigns. Subject to any restrictions on transferability contained in this Agreement, this Agreement and all of its provisions shall be binding on and inure to the benefit of the heirs, legal representatives, successors and assigns of the parties. Any assignment of this Agreement by the Optionee shall be subject to the Optionor’s approval. Optionor shall have the right to assign this Agreement. j) Time of the Essence. All times and dates in this Agreement are of the essence. k) No Waiver. A party's failure to insist on the strict performance of any covenant of duty required by this Agreement, or to pursue any remedy under this Agreement, shall not constitute a waiver of such breach or such remedy. l) Severability. If any part of this Agreement is determined to be illegal or unenforceable, all other parts shall remain in effect. 5. Notices. All written notices required to be given pursuant to the terms hereof shall be transmitted by email, with a copy sent within one (1) business day by any of the following means: (a) personally delivered; (b) deposited in the United States express mail or first class mail, registered or certified return receipt requested, postage prepaid; (c) sent by Federal Express or similar nationally recognized overnight courier service. Each notice shall be addressed as follows: Final 5 Optionor: Young Kim & Mija Kim Attention: Mr. Young Kim Telephone: Address: E Mail: Optionee: Community Veterans of Fresno, LLC d/b/a CAKE Daniel Wise Saad Pattah Attention: Daniel Wise Telephone: E Mail: The foregoing addresses may be changed from time to time by written notice. Notices shall be deemed received upon the earlier of actual receipt or the first attempted delivery, provided that if a notice is sent by facsimile or email on a weekday after 5:00 p.m. Pacific time or on a weekend or holiday, it shall be deemed to have been sent on the next business day, and provided further that, in the case of a facsimile, the sender shall have received a “TCR” or transmission delivery sheet generated by its fax machine and, in the case of an email, the sender shall not have received a delivery “failure” or similar message. 6. Governing Law. This agreement shall be governed by and construed according to the laws of the State of California. 7. Attorneys ’ Fees. If any legal action, including arbitration or an action for declaratory relief, is brought to interpret or enforce the provisions of this Agreement, the prevailing party or parties shall be entitled to recover reasonable attorneys ’ fees from the other party or parties. These fees, which may be set by the court in the same action or in a separate action brought for that purpose, are in addition to any other relief to which the prevailing party or parties may be entitled. 8. Confidentiality. The parties represent and agree that they will keep the terms and contents of this Agreement confidential, and that they will not hereinafter disclose the terms of this Agreement to other persons except as (i) required by the process to obtain the Entitlements, (ii) compelled by applicable law, or (iii) as otherwise consented to by the other party. [Signature Page to Follow] Final 6 IN WITNESS WHEREOF, the parties hereto have caused this Agreement to be executed as of the day and year first above written. OPTIONOR: Young Kim By: Young Kim Sign: ____________________________________ Mija Kim By: Mija Kim Sign: ____________________________________ OPTIONEE: Community Veterans of Fresno, LLC d/b/a CAKE By: Cake Enterprises, Inc Its: Manager By: Daniel Wise Its: Authorized Signatory Sign: _____________________________________ Community Veterans of Fresno, LLC d/b/a CAKE By: Cake Enterprises, Inc Its: Manager By: Saad Pattah Its: Authorized Signatory Sign: ____________________________________ PLANNING AND DEVELOPMENT DEPARTMENT 2600 Fresno Street • Third Floor Jennifer K. Clark, AICP, Director Fresno, California 93721-3604 (559) 621-8277 FAX (559) 498-1026 November 19, 2020 Please reply to: Rob Holt (559) 621-8056 Daniel Wise 1611 S Melrose Dr, Ste A #391 Vista, CA 92081 Dear Applicant: SUBJECT: ZONING INQUIRY NUMBER P20-04169 REQUESTING INFORMATION REGARDING CANNABIS RETAIL FOR PROPERTY LOCATED AT 3034 EAST MCKINLEY AVENUE (APN 415-091-13) Thank you for your inquiry regarding the allowance of new cannabis retail uses. The requested information about cannabis retail uses was analyzed using Article 27, Chapter 15 of the Fresno Municipal Code (FMC) of the City of Fresno. Please note, all research for this inquiry is based on existing land development of the subject property. If there are multiple buildings on the subject property, this research was based on the address provided in the request. This research does not take into effect of future development unless provided in your application request. With that, research of a proposed cannabis retail business on the subject property conveys the following: 1. All cannabis retail businesses must be located on property zoned DTN (Downtown Neighborhood), DTG (Downtown General), CMS (Commercial Main Street), CC (Commercial Community), CR (Commercial Regional), CG (Commercial General), CH (Commercial Highway), NMX (Neighborhood Mixed-Use), CMX (Corridor/Center Mixed- Use), RMX (Regional Mixed-Use), and must meet all of the requirements for development in these zones, including, but not limited to, parking, lighting, building materials, etc. The subject property is zoned CG, which is one of the allowable zone districts for cannabis retail businesses. Development standards of the CG zone district are available in Sections 15-1203, 15-1204, and 15-1205 of the FMC. The subject location meets the zone district requirement, per Section 15-2739.B.1.a of the FMC, for a cannabis retail business. 2. All building(s) in which a cannabis retail business is located shall be no closer than 800 feet from any property boundary containing the following: (1) A cannabis retail business; (2) A school providing instruction for any grades pre-school through 12 (whether public, private, or charter, including pre-school, transitional kindergarten, and K-12); (3) A day care center licensed by the state Department of Social Services that is in existence at the time a complete commercial cannabis business permit application is submitted; and, (4) A youth center that is in existence at the time a complete commercial cannabis business permit is submitted. Zoning Inquiry P20-04169 3034 East McKinley Avenue Page 2 November 19, 2020 Although the subject property is located within 800 feet of San Joaquin Memorial High School, the existing multi-tenant retail building, located at 3034 East McKinley Avenue (east end of the building per the provided site plan) on the subject property is not located within 800 feet of the property boundary of any of the above-mentioned uses. The subject building meets the separation requirements, per Section 15-2739.B.1.b of the FMC, for a cannabis retail business. 3. Prior to commencing operations, a cannabis retail business must obtain a Cannabis Conditional Use Permit from the Planning and Development Department per Section 15- 2739.N of the FMC. 4. No more than 2 cannabis retail businesses may be located in any one Council District. If more than 14 are ever authorized by Council (more than 2 per Council District), they shall be dispersed evenly by Council District. The subject property is in Council District 7. There are currently no cannabis retail businesses located in Council District 7. This location requirement is satisfied for a cannabis retail business. Please review the entirety of Article 33, Chapter 9 (Cannabis Retail Business and Commercial Cannabis), and Section 15-2739 (Adult Use and Medicinal Cannabis Retail Business and Commercial Cannabis Business) of the FMC to understand other requirements of cannabis retail businesses, including but not limited to, application requirements, signage, etc. This information was researched by the undersigned per the zoning request. The undersigned certifies that the above information contained herein is believed to be accurate and is based upon, or relates to, the information supplied by the requestor. The City of Fresno assumes no liability for errors and omissions. All information was obtained from public records held by the Planning and Development Department. A copy of the Fresno Municipal Code may be obtained by contacting the City Clerk’s office at 559-621-7650. The Fresno Municipal Code may also be searched on the Internet, free of charge, by going to www.fresno.gov. If you have questions regarding this matter, please contact me by telephone at 559-621-8056 or at Robert.Holt@fresno.gov. Cordially, Rob Holt, Planner III Development Services Division Planning and Development Department M C K I N L E Y A V E D R Y C R E E K C A N A L N F I R S T A V E SCOPE OF WORK PROPOSED DISPENSARY 4500 SF SOLAR CANOPY DISPENSARY PARKING RIDESHARE PARKING LOT 2159 India St. San Diego CA. 92101 info@heleo.co SET NOT FOR COUNSTRUCTION All Dimensions to be verified on site All ideas, designs and plans indicated or represented by these drawings are owned by and are property of Heleo Architecture and Design and were created and developed for use in connection with the specified project. None of such ideas, designs or plans shall be used for any purpose whatsoever without the written permission of Heleo © 2020 Heleo Architecture and Design. 1" = 40'-0"11/20/2020 7:37:59 PM SITE PLAN MCKINLEY AVE CAKE A0023034 - 3072 E MCKINLEY AVE, FRESNO CA 93703 KEYNOTES PROPOSED DISPENSARY 4500 SF DRA F T 3URRIRI)XQGV9HULILFDWLRQ Ϯ '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 '$7( $&&281712 [[[[[[[[ $&&28177<3( &+(&.,1* %$/$1&( 86' '(6&5,37,21 9(5,),&$7,212))81'6 (BBBBBBBBBBBBBBBBBB !)+ ' BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB * +,)(&&2%()0(-)' 25 *+)/ -)' )(-# ,$,)!WKHRDWKRIBBBBBBBBBBBBBBBBBBBBBBBBBBBBB25 SURYHGWRPHRQWKHEDVLVRIVDWLVIDFWRU\HYLGHQFHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7\SHRI,'3UHVHQWHG WREHWKHLQGLYLGXDOVZKRVHQDPHVLVDUHVXEVFULEHGWRWKHZLWKLQLQVWUXPHQWDQG DFNQRZOHGJHGWRPHWKDWKHVKHWKH\H[HFXWHGWKHVDPHLQKLVKHUWKHLUDXWKRUL]HGFDSDFLW\LHV DQGE\SURSHUDXWKRULW\DQGWKDWE\KLVKHUWKHLUVLJQDWXUHVRQWKHLQVWUXPHQWWKHLQGLYLGXDOV RUWKHSHUVRQVRUHQWLW\XSRQEHKDOIRIZKLFKWKHLQGLYLGXDOVDFWHGH[HFXWHGWKHLQVWUXPHQWIRU WKHSXUSRVHVDQGFRQVLGHUDWLRQWKHUHLQVWDWHG " * +,)(&&2** + BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB '(6&5,37,212)$77$&+(''2&80(17 $-& )+2* )! ).' (-BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB ).' (- - BBBBBBBBBBBBBBBBBBBBBBBBB.' +)!" ,0 +-$!$- BBBBBBBBBBB $"( +,-# +#(' )/ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &!)+!("!#+!$'( $"( +5,' BBBBBBBBBBBBBBBBBBBBBBB &!)+!("!#+!$'( $"( +5,' BBBBBBBBBBBBBBBBBBBBBBB )+*)+- !!$HU$-& BBBBBBBBBBBBB +-( +4$'$- ( +& ($/$.&--)+( 2$(- +.,- .+$()I )(, +/-)+ -# +BBBBBBBBBBBBBBBBBBBBBBBBBBB $"( +, *+ , (-$("BBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB )+*)+- !!$HU$-& BBBBBBBBBBBBB +-( +4$'$- ( +& ($/$.&--)+( 2$(- +.,- .+$()I )(, +/-)+ -# +BBBBBBBBBBBBBBBBBBBBBBBBBBB $"( +, *+ , (-$("BBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6WDWH )'')(0 &-#)!BBBBBBBBBBBBBBBBBBBBBBB $-2 ).(-2)!BBBBBBBBBBBBBBBBBBBBBBB '2#(()!!$$&, & 1RWDU\3XEOLF$"(-.+ BBBBBBBBBBBBBBBBBBBBBBBBB 1RWDU\1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB )-+\&RPPLVVLRQ.' +BBBBBBBBBBBBBBBBBBBBBB 1RWDU\ )''$,,$)(1*$+ ,BBBBBBBBBBBBBBBBBBBBBB 1RWDUL]HGRQOLQHXVLQJDXGLRYLGHRFRPPXQLFDWLRQ RI&UHGLEOH:LWQHVV FLORIDA 10/20/2020 Eddy Petit-Bois Eddy Petit-Bois HH537 05/17/2024 14 14 driver_license Saad Pattah, Daniel Wise proof of funds verification palm beach 10/20/2020 N/A N/A BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB Notarized online using audio-video communication Electronic Notary Public cake enterprises inc Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 1 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Commercial Cannabis Business Application Prepared for the City of Fresno Applicant: Community Veterans of Fresno LLC dba Cake Address: 3034 E. McKinley Ave. Fresno, CA 93703 APN: 451-091-13 District: 7 License: Retail Storefront Proposal Date: 12/4/2020 Honesty | Excellence | Respect | Innovation | Stewardship | Hospitality | Customer Service Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 2 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 CONTENTS 1 Business Plan ......................................................................................................................................................3 1.1 Owner Qualifications ...................................................................................................................................3 1.2 Budget for Construction and Operational Costs .......................................................................................21 1.3 Proof of Capitalization .............................................................................................................................28 1.4 10 Year Proforma .....................................................................................................................................31 1.5 Hours of Operation and Opening and Closing Procedures .......................................................................34 1.6 Daily Operations .......................................................................................................................................37 2 Social Policy and Local Enterprise Plan ..........................................................................................................66 2.1 Commitment to Living Wages .................................................................................................................67 2.2 Employee Benefits ....................................................................................................................................68 2.3 Continuing Education and Employee Training ........................................................................................73 2.4 Recruitment Plan and Social Policy .........................................................................................................74 2.5 Locally Managed Enterprise .....................................................................................................................78 2.6 Employees, Title/Position, and Responsibilities ......................................................................................83 2.7 Labor Peace Agreement ...........................................................................................................................85 2.8 Workforce Plan .........................................................................................................................................89 2.9 Social Equity Incubator Plan ....................................................................................................................90 3 Neighborhood Compatibility Plan ....................................................................................................................92 3.1 Addressing and Responding to Complaints ..............................................................................................93 3.2 Nuisance Avoidance Policies ...................................................................................................................95 3.3 Odor Mitigation Practices .........................................................................................................................95 3.4 Potential Sources of Odor .........................................................................................................................96 3.5 Odor Control Devices and Techniques .....................................................................................................96 3.6 Staff Odor Training and System Maintenance .........................................................................................97 3.7 Waste Management Plan ..........................................................................................................................99 4 Safety Plan ......................................................................................................................................................105 4.1 Professional Fire Prevention and Suppression Consultant .....................................................................106 4.2 Accident and Incident Reporting Procedures .........................................................................................109 4.3 Evacuation Routes ..................................................................................................................................112 4.4 Location of Fire Extinguishers and Other Fire Suppression Equipment ................................................114 4.5 Fire and Medical Emergency Training and Procedures .........................................................................117 5 Security Plan...................................................................................................................................................119 5.1 Professional Security Consultant ............................................................................................................120 5.2 Premises (Security) Diagram ..................................................................................................................126 5.3 Intrusion Alarm and Monitoring System ................................................................................................127 5.4 Cash Handling Procedures .....................................................................................................................144 5.5 On-Site Security Guards .........................................................................................................................146 5.6 Visitor Access Control ...........................................................................................................................153 5.7 Employee Security Education ................................................................................................................154 6 Location ..........................................................................................................................................................160 6.1 Description of Location ..........................................................................................................................161 6.2 Location Street View ..............................................................................................................................166 6.3 Premises (Site) Diagram .........................................................................................................................167 7 Community Relations Plan .............................................................................................................................178 7.1 Social Responsibility Plan ......................................................................................................................179 7.2 Public Health Outreach and Educational Program .................................................................................190 7.3 Contributions to Fresno Community Reinvestment Fund ......................................................................194 7.4 Historical Community Involvement .......................................................................................................196 Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 3 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1 BUSINESS PLAN The Future of Cannabis Retail in Fresno. Honesty | Excellence | Respect | Innovation | Stewardship | Hospitality | Customer Service Cake plans to upgrade and modernize this entire facility, parking lot, and ultimately beautify an old battery store! This includes a ride sharing pick-up location, solar powered vehicle coverage, and electric vehicle charging! Be sure to read the details in the site plan! Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 4 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1 OWNER QUALIFICATIONS Community Veterans of Fresno LLC encompasses a team of highly experienced and knowledgeable individuals with a passion to bring an industry leading, commercial cannabis retail facility to the residents of Fresno. The Community Veterans of Fresno team presents the expertise of planning, developing, and operationalizing compliant and successful commercial cannabis businesses. To achieve such success, each team member offers a unique set of strengths ranging from operational excellence and people leadership to managing finance and marketing and ensuring legal compliance. Community Veterans of Fresno’s President and CEO, Daniel Wise, is a successful entrepreneur that has successfully owned and operated 3 other cannabis business’ including retail, cultivation, and manufacturing facilities. He is very experienced in developing commercial cannabis businesses from the ground up and has personally oversaw these projects from inception to completion. Saad Pattah, a managing member, is a serial entrepreneur who has demonstrated success in the grocery, restaurant, and import and export industries. Daniel and Saad have successfully recruited a top notch team of Fresno residents to kick this project off! Paul Cornacchia is a highly skilled Fresno resident who will serve as the Security Manager at the Community Veterans of Fresno facility. He has more than 12 years of experience in the Security Industry with several years of experience with onboarding and training security staff. He has a firm grasp of security and safety best practices in a commercial setting as well as familiarity with OSHA safety and reporting requirements. Kara Castaneda is an accomplished and energetic manager with 17 years of experience in a fast-paced retail environment and a solid history of achievement in management. She is a motivated leader with strong organizational and prioritization abilities. Her areas of expertise include retail, customer service, and people management. While the talent of this team cannot possibly be summed up in a single page, this team’s power comes with each person bringing a unique set of strengths to the Community Veterans of Fresno team. The team is confident that the combined efforts of these individuals, with the detailed plan outlined in the following application, Community Veterans of Fresno will show the City of Fresno the company’s preparedness to successfully integrate and add value to the Fresno community and ultimately deliver a unique customer experience that is compliant and adheres to local and state requirements. Why Us? Community Veterans of Fresno is a Veteran owned and managed busines who have the business experience to create a safe and sustainable commercial cannabis facility. The company aims to serve the Fresno community by providing high quality products and exceptional customer service. With a lifetime of service, Community Veterans of Fresno has a passion to contribute to the advancement of the community by offering generous financial contributions and volunteer hours. The City of Fresno can expect a business that is managed with the customers, community, and employees in mind. Officials can rest assured that they have selected a company that will uphold the high standards that Fresno citizens should expect out of a cannabis retailer. Join us in our mission of bringing quality cannabis to every person who can benefit! Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 5 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Lance Rogers General Council Charlena Berry Compliance Fidelity Security Solutions Guard Service Patrick Chown Safe and Sound Security Paul Gantt Safety Compliance Management Carlos Hernandez Architectural Design Green Growth CPAs CPA Mechanical Engineer Odor Control 1.1.1 Organizational Chart Cake Enterprise, Inc. owns Community Veterans of Fresno. Cake Enterprises, Inc. is owned by Daniel Wise and Saad Pattah. Daniel and Saad are funding the Community Veterans of Fresno project. Community Veterans of Fresno will operate under the ficticious name of Cake. Below is the anticipated organizational chart for Community Veterans of Fresno. Daniel Wise will be responsible for overseeing the overall company direction and expansion opportunities. Hilary Traina will be responsible for the day to day operations. 1.1.2 Professional Team of Experts Community Veterans of Fresno has a assembled a top-notch team of 3rd party experts to ensure that we are designing a business that will be successful, profitable, and well-designed with top of the line equipment and procedures that keep the customer in mind. Community Venterans of Fresno Saad Pattah Managing Member Daniel Wise President & CEO Sara Gutierrez Board Advisor Cynthia Nelson Board Advisor Hilary Traina General Manager Heather Weatherly Procurement Manager Kara Castaneda Sales Manager Desiree Torosian Public Relations Manager Paul Cornacchia Security Manager Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 6 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.3 Daniel Wise – President and CEO Daniel Wise will serve as Community Veterans of Fresno’s President and CEO. He is a visionary, astute, and resourceful professional with more than 10 years’ experience in commercial cannabis development, cannabis retail project management, brand development, and account management. A decorated veteran, he served in the US Navy at Camp Pendleton for 4 years earning Honors Graduate for Chaplain and Religious Program Specialist Expeditionary Skills Training, Commanding Officer of Field Medical Training Battalion-East, Military Order of the Purple Heart Foundation for RPSES Training, and Basic Enlisted Submarine School in Groton, CT. He was awarded "Top Doc" for Fleet Medical Training Battalion- East Class 15010 and received the Enlisted Surface War-fare Specialist Pin Award as well as the Fleet Marine Force Specialist Pin Award. After scoring remarkably high on the ASVAP, he was chosen to attend the Navy’s Nuclear Submarine School. He earned a Lean Six Sigma Green Belt from Navy College and is Certified Hydroponicist from Cal Poly Pomona. At the College of the Desert, he earned a Cannabis Compliance Certificate and Cannabis HR Certificate. He is currently working toward a Bachelor of Business and Managerial Economics from DeVry University. Prior to his enlistment in the US Navy, Mr. Wise spent 2 years working as an Agricultural Operations Manager at Rocking W Ranch in Texas. Rocking W Ranch is one of Texas’ most iconic ranches with more than 36,000 acres of paved and ranch roads. In this role, he was responsible for hiring and training ranch workers, managing financial, operational, and production records, as well as maintaining high standards of animal welfare which included monitoring irrigation, breeding, and grading activities to ensure the adherence to safety regulations. Simultaneously, Mr. Wise served as an Account Manager for Plastic Molding Technology where he managed a portfolio of $45,000,000 across 75 accounts. He expanded his clientele base by 17% and became the highest grossing sales representative across all 16 sales offices in the USA within 1 year. A serial cannabis business entrepreneur, in 2015, Mr. Wise founded Veterans Medical Alternatives, a licensed medical cannabis collective which oversaw the provision of treatment and research for PTSD, depression, and anxiety for Veterans across the State of California. In 2016, Mr. Wise founded Veterans Organic Solutions, a premier manufacturing, distribution, and retail facility that worked in conjunction with the VMA to provide Veterans access to legal cannabis in California. In this role, not only did he oversee all budgetary aspects of the company, but he also managed the operations of the cultivation facility including harvesting, processing, and distribution. In 2019, Mr. Wise founded Wise Enterprises, Inc in San Diego. This is a real estate development company that currently holds $7 million in real estate assets. Additionally, in 2019, he co-founded Coastal Wellness Dispensary and Green Venture Farms where he serves at the Chief Operating Officer. Finally, Mr. Wise is the founder of Currnt Cannabis, Inc which has 4 dispensaries in various phase of development, as well as 100,000 square feet of authorized canopy, a Type 7 volatile manufacturing facility, and an umbrella of brands that include flower, concentrates, distribution, and retail delivery operations. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 7 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 8 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.4 Saad Pattah – Owner Saad Pattah is a Managing Member and founder of Community Veterans of Fresno. He is a serial entrepreneur who has demonstrated success in the grocery, restaurant, and import and export industries. Mr. Pattah began his professional career in his family’s business, Viva Market in Oceanside. He started as a cashier and slowly grew his experience and in 2008 became the General Manager overseeing operations and management of the facility. Under his leadership and with his dedicated work ethic, he grew the business more than 300% by drastically improving efficiencies and reducing costs. His keen eye for detail and commitment to customer service was imperative to the Viva’s success. In 2011, Mr. Pattah purchased Smith NS Foods Inc which was a small company with a single location. Under Mr. Pattah’s leadership, he developed a robust internally integrated distribution model which allowed the company to expand to multiple locations across Southern California exponentially increasing the market penetration and brand revenue. Given his proven entrepreneurial success, in 2012, Mr. Pattah saw a major opportunity to enter the restaurant industry with the growing sushi market. He founded Sushi Ventures Inc DBA Tabu Sushi. Mr. Pattah opened the first keystone restaurant, Tabu Sushi and proved that his evaluation of the demographic and opportunity was accurate. Given the success of the first restaurant, Mr. Pattah has continued to expand Sushi Ventures Inc across multiple locations in California. His industry intuition has been imperative to the success of the vertically integrated restaurant chain. Tabu Sushi continues to grow every year and expand into new markets across California. In 2016, Mr. Pattah founded Sky & Lana Group Inc, which is a successful import and export business that is still currently operating. In this venture, Mr. Pattah uses his knowledge of international business and strategic business development to diversify the company portfolio to increase revenue. Mr. Pattah’s ability to negotiate international business transactions and manage the logistical challenges, is why Sky & Lana Group has continued to outpace growth faster than the industry standards. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 9 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 10 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.5 Cynthia Nelson – Board Advisor Cynthia Nelson is the Director of Marketing and Event Planning. Her expertise was built from 12 years of hands-on experience in event planning, coordination, and project execution. Her keen attention to detail, skilled communication, and effective in-person and behind the scenes leadership, creates memorable product and people connections. She has had the privilege to coordinate and provide special events for presidential caucus’, foreign dignitaries, celebrities, musicians, televisions hosts, and tech moguls (both in private and large-scale events). As a Director, she maintains the professional and relational connection to our current clients, as well as building connections with our future clients and customers. Her focus is to enhance our mission of serving veterans and our customers, through branding and industry centered events. Mrs. Nelson received her bachelor’s degree in Education, and The Psychology of Human Development. Prior to her time in event planning and coordination, she taught both primary school and junior high. These years were formative in the development of her intentional leadership, subject matter expertise, communication skills, and her passion for organizing events and fundraisers. For her, the ability to collaborate and create an experience that can last a lifetime is absolutely energizing. Though she loves teaching, she chose to move in a new direction, where she ran her own business for several years. During this time, she developed and fine-tuned her skills in marketing, and branding, while maintaining a clear focus on event management. With her professional background, she was able to create a cohesive blend of experiences that drives her love and passion to create and develop further relationships and events that are memorable for our patrons and accurately reflect our brand. Mrs. Nelson is the proud daughter of a US Navy Veteran, who faithfully served this nation to gain his US citizenship. She was also a military spouse for over 10 years. As a first generation Mexican-American, she understands the importance of a strong work ethic, family and building relationships. She enjoys traveling, entertaining, and spending time on the water with her 4 children and husband splashing or paddling around. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 11 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.6 Sara Gutierrez – Board Advisor Sara Gutierrez is a versatile and reliable business professional with more than 8 years of experience supporting managers and executives in high paced environments. With a remarkably diverse skill set, Sara is comfortable in nearly all sectors of business with proven success leading areas such as client relations, human resources, recruiting, project management, and administrative support. With excellent phone and digital communications skills, Sara has crafted award-winning campaigns for a wide variety of clients and products. Sara additionally has experience in start-up support and establishing operations leveraging her expertise in organizational structure, computer networking, and problem resolution. Sara has generated an impeccable professional reputation for herself, known for her creativity, flexibility, and proven analytical skills. Sara started her professional career in 2008 with her employment at Wells Fargo. Sara joined Wells Fargo shortly after the financial crash of 2008 because of her passion to try and make things better and to create more efficient processes within institutions. Sara's dedication to Wells Fargo, and her unwavering work ethic, led to numerous promotions and recognition during her employment. She was named as a top rated performer for multiple years and recommended for promotion in the top percentile. After her departure from Wells Fargo, Sara took her talents and decided to join a new team at CitiBank. CitiBank actively recruited Sara as a prime candidate in the banking community because of her dedication and work ethic shown at Wells Fargo. Sara's work was paramount in the success of multiple CitiBank locations as she utilized her process efficiency acumen to improve processes and create more positive working experiences for employees. Her dedication led to multiple events of recognition which allowed her to have an even deeper impact on the culture of CitiBank. After taking time off in her career for her growing family, and after evaluating the tremendous opportunities available in commercial real estate, Sara made the transition into the commercial real estate industry in 2017. Her past experience with versatility and process efficient made her an instant success at ShopCore Properties, where she is still actively employed. Her attention to detail allowed her to move seamlessly from banking to commercial real estate and made her a tremendous asset to the ShopCore team. Outside of managing her career and caring for her family, Sara is also passionate about giving back to the community. She spends her free time as a volunteer assistant cheer coach for San Marcos Pop Warner. She also is an active member of the San Diego Food Bank. Sara’s skillset, work ethic, and professional experiences are no doubt an asset to the Community Veterans of Fresno team. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 12 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.7 Hilary Traina – General Manager Hilary Traina is a longtime resident of Fresno and skilled business professional. She is experienced in general business management stretching across several different industries. She is also educated in areas of Real Estate Practice, Real Estate Principals and Real Estate Finance. Hilary has worked as an Executive Assistant and Event Coordinator for the last 3 years for Netafim, located in Fresno, CA. She has served as the assistant to four of the company's five chief executive team members, including the CEO. She was able to thrive due to her outstanding time management skills, writing abilities, and commitment to excellence. Beyond providing administrative support to chief leaders for the company, Hilary further maintained and analyzed the company P&L and, in part due to her analysis, profits increased by approximately 30%, accounts receivable reduced by 40%, accounts payable and overall company debt decreased by 20%. With a $1M event budget, Hilary conducted monthly ROI analysis and coordinated annual incentive retreats for VIP clients both domestically and internationally as well as more than 80 tradeshows annually managing booth procurement, hotels, logistics, speaking opportunities and sponsorships. Prior to her role with Netafim, Hilary fulfilled the role of Sales Support and Onboarding agent for nearly 4 years at Corteva Agri Science (formally known as DuPont) in Fresno, CA. Within this role, Hilary was responsible for managing the trade show budget across multiple departments and the coordinated execution in all trade shows ranging from 20,00 to 100,000 participants. Hilary was responsible for managing the logistics and post event or ROI analysis for each event. Further, Hilary worked to drive lead generation and promote brand awareness through heavily themed networking events in conjunction with key trade shows. She developed event concepts and managed full execution, drew in production and entertainment companies, coordinated event staff, and maintained relationships with various venues, nightclubs, and hotels nationally. Hilary provided support to a team of over 100 salespeople with their administrative responsibilities, sales forecasting, travel, and budgets. She also managed the full scope of HR activities within an international company, including development of a safety program, policy manual, employee meetings, and staff recruitment. Hilary has additional business experience derived from several years working in highly regulated industries such as the Internal Revenue Service and Aetna Health Insurance. During her 5 years with the IRS, Hilary processed tax returns in adherence to both state and federal regulation. She often would have to perform investigative duties to verify the validity and accuracy of the claims. At Aetna Health Insurance, Hilary built strategic business plans detailing initiatives for operation improvement and targeting marketing for company growth. She often participated in industry seminars, conferences, trade exhibits, networking events, and other public speaking opportunities to continually promote and provide education about the company’s products and services. Hilary’s experience has brought to understand the importance of being proactive, anticipate roadblocks, and create effective alternative plans. She is enthusiastic and welcomes a challenge and is very excited to begin her journey in the cannabis industry. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 13 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.8 Desiree Torosian – Public Relations Manager Desiree Torosian is an accountable medical professional who demonstrates a high level of ownership and initiative. She possesses quick and effective at decision making, while maintaining superior customer service throughout the entire administrative process. Desiree is a team-oriented business associate who works well in a collaborative environment yet thrives on personal achievements. Desiree currently works as Client Relationship Specialist. She has a medical assisting degree from Santa Barbara Business College and is certified in medical billing and coding, phlebotomy, child development, gang and domestic violence prevention, and teen pregnancy prevention. She previously held the position of Unit Director and Mentor at Fink White Boys and Girls Club non-profit organization where she was responsible for mentoring and nurturing youths from ages 6-19. She gathered personal and confidential information pertaining to each child, taught and ran multiple programs that aimed to benefit child development, such as: • Safer Choices (sex ed), Healthy Habits (healthy eating and excessive) • Keystone (training teens to be leaders) • Smart Girls (teaching life skills to girls 9-13) • Triple play, (sports programs and coaching to kids ages 6-19) • Diploma to Degrees (helps teens achievement school and career goals) • Passport to manhood (working with boys 9-15 on hygiene and responsibility training). She was also responsible for Grant Reports and facility concerns, Parent outreach and community projects and outreach to outside non-profit organizations. She facilitated community events and Club outings and educational field trips. She established relationships that allowed her to work side by side with other organizations such as Marjaree Mason Foundation, Planned Parenthood, Fresno Police Department, Fresno Housing Authorities, Bringing Back Broken Neighborhoods, and several other organizations. These relationships are certainly ones that Desiree keeps near and dear as she continues to support the community in any way she can, especially as it pertains to the youth within the community. Desiree currently works as Client Relationship Specialist at Aspire Speech & Learning Center where she has worked for a little more than a year. She assists in running the front office of a speech therapy, occupational therapy, and tutoring center. She works with both Central Reach and Practice Perfect scheduling systems, order SLP protocols and supplies and keeps the office organized, stocked, and current. Further, she manages the office’s medical coding and billing. Desiree has many ties within the community. She is the first person to volunteer for local events and community outreach. She is a mother of three children and multiple fur babies. Desiree’s motto in life is, “Together We Can Make a Difference.” Desiree has an outgoing personality and loves to sing and dance. She has recently accepted a role as a lead actress in a short film for Fresno Financial Literacy Film Festival. She has also taken on the challenge of being our media representative. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 14 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.9 Paul Cornacchia – Security Manager Paul Cornacchia is a highly skilled Fresno resident who will serve as the Security Manager at the Community Veterans of Fresno facility. He has more than 12 years of experience in the Security Industry with several years of experience with onboarding and training security staff. He has a firm grasp of security and safety best practices in a commercial setting as well as familiarity with OSHA safety and reporting requirements. This experience comes from years of working various roles in the field. Paul currently works as an Amazon Fulfillment Warehouse Safety Team Coordinator. He is responsible for managing and training the Amazon Safety Team. He works to ensure employee’s and the fulfillment warehouse is in compliance with OSHA & Amazon Safety requirements. Prior to his role at Amazon, Paul served as the Director of Sales and Customer Care for Priority First Security, an ADT authorized security provider in Fresno, CA, where he worked for nearly 11 years. In this role, Paul was responsible for hiring and training all smart security agents and new direct marketers. He developed training material and operational procedures for Team Closers and Managers and managed multiple locations throughout California. He often facilitated training sessions as well as motivational and manager meetings. Beyond training, Paul also developed a department focused on Customer Care aimed to resolve customer issues and address customer concerns. Additionally, he oversaw the collections department and monitored overall company metrics such as day to day sales and company attrition rates. His analytical mindset and attention to detail allowed him to analyze the data and make recommendations to company leaders regarding paths for improvement. Under Paul’s management, the company was able to improve overall customer satisfactions ratings, grow sales, and reduce attrition rates down to 2% for the entire company. Paul was highly valued by the company for his eye for the big picture. Paul has additional experience as a Campus Director, a role he fulfilled at the Clinical Training Institute, Fresno School of Phlebotomy where he was directly responsible for all day to day operations. His duties included marketing, scheduling, new student enrollment, directing instructors, facilitation of monthly information seminars and new student orientation, billing, inventory management, and maintaining state compliance. Paul has a strong work ethic and is self-motivated, He is energetic, resourceful, and creative about finding solutions. His excellent communication, presentation, analytical and listening skills will make is a great fit to the team. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 15 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.10 Heather Weatherly – Procurement Manager Heather Weatherly is Fresno resident and a highly qualified business professional. She holds a bachelor’s degree in Art History from San Diego State University and an associate degree in Liberal Arts from Vista Community College. Heather has more than 3 years of experience as a project manager. She currently works as a Leasing Agent for JRK Property Holdings in Fresno, CA. She is responsible for maintaining contact with all leads and prospects using Entrada software. She develops lease agreements and renewals using eSite software and coordinates move ins. She conducts move out inspections, generates work orders, and is responsible for monitoring progress of maintenance. She maintains relationships with tenants and monitors all company properties, matching tenants with properties that fit their needs. Heather previously held a similar position as Assistant Property Supervisor at Nelson Properties and Domus Management Company. In these roles she supported multiple property managers for several apartment communities and commercial spaces. She oversaw leasing, maintenance, move outs, and inspections. She also was responsible for the management of accounts receivable, accounts payable, recorded payments to tenant ledgers using Yardi software and Excel for apartment turn progress. She processed rent payments and used 10‐key to batch rent payments. Heather has been accountable for the management of up to 48 apartment units, managing all aspects of the rental tenant relationships. She has managed renovation and building projects, contracting, and coordinating with multiple vendors while maintaining the overall project budget and timelines. These experiences have brought Heather to fully understand various aspects of project management and maintaining vendor relationships. As the project manager in the property management industry, she also became quite familiar with how to navigate through a highly regulated industry. She understands the importance of researching codes and ordinances to ensure projects maintain compliance at each and every level. In addition to her Project Management career, Heather is also an On-Call substitute teacher for Pre-School through the 12th grade. She also helps out in special education classes when needed. Heather is truly an incredibly talented individual who takes on new challenges with enthusiasm and seeks success in each and every task. She is a team player and takes pride in doing what she can to help the people around her. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 16 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.11 Kara Castaneda – Sales Manager Kara Castaneda is an accomplished and energetic manager with 17 years of experience in a fast-paced retail environment and a solid history of achievement in management. She is a motivated leader with strong organizational and prioritization abilities. Her areas of expertise include retail, customer service, and people management. Kara’s professional career started in 2000, just after graduating from Bullard High School of Fresno, CA when she took a job at the retail giant, Walmart. Kara held various positions over the course of her 18 years of employment with the company. She held many managerial roles rotating to different departments and locations. The company truly valued her flexibility and willingness to accept whatever responsibilities they needed from her. She enjoyed the challenge and the opportunity to learn. Throughout the duration of her employment with the company she took on a variety of responsibilities ranging from customer service to employee training and leadership. She oversaw several different departments within the retail chain including retail floor departments, merchandising, inventory management, staffing, scheduling, training, customer service, and sales. She further led the cash office where she was responsible for reconciling sales reports, prepared cash drops and bank deposits, check processing, and prepared cash drawers for sales associates for shift changes. Kara was responsible for managing all inventory processes for the departments she oversaw. This included monitoring inventory levels, reordering inventory when needed, receiving incoming inventory, and pricing inventory. She was also responsible for reconciling inventory and performing regular and mandatory inventory audits. Further, she developed and implemented policies, goals, objectives, and procedures for each of her departments. Beyond day to day operations, Kara was also responsible for managing other department managers and staff. She 7 department managers and 22 sales associates where she managed hiring, scheduling, onboarding, and training, activities. She was responsible for monitoring performance, conducting regular performance reviews, providing employees with feedback, and individual goal setting. In 2018, Kara decided to use all the experience and skills she got from her career with Walmart and decided to open her own company, J&J Towing and Recovery Inc. She managed all day to day operations including scheduling, property collection, customer service, invoicing, and maintenance. She was also responsible to ensure all company policies and procedures maintained compliance with the regulations set forth by the Department of Transportation. Kara is a natural leader with the ability to find the path to success in each and every endeavor she takes on. Her strengths and ability to manage several activities at one time will serve her well as the Sales Manager for Community Veterans of Fresno. Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 17 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.12 Cannabis Business Experience Licenses Currently Held As shown above, this team possesses a wealth of cannabis business experience. The principal owners bring the knowledge of commercial cannabis business operations and legal compliance so the city can rest assured that this team will create a sustainable and trustworthy cannabis operation within the city of Fresno. To further demonstrate the knowledge and experience this team possesses, the owners of Community Veterans of Fresno is providing the licenses that they are currently affiliated with for the City to review. State Licenses 1. Coastal Wellness - Provisional Medicinal Retail Storefront - License No: C10-0000680-LIC o Located in Vista, CA - Valid through 1/16/2021 Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 18 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Local Licenses 1. Green Venture Farms, INC. - Medical-Only Cannabis Local License - Local License No: MCF-1264826 o Located in Oceanside, CA - Valid through 4/9/2021 2. Veterans Organic Solutions, LLC - Conditional Use Microbusiness Permit No:2018-08 o (Manufacturing, Distribution, Retail) Located in Lake Elsinore, CA (Closed 7/22/2019) 3. CURRNT Veterans Wildomar Central, LLC – Approved - 10/01/2020 o (Retail) – Project PA 20-0083 o 23080 Wildomar Trail, Wildomar, CA, 92595 4. CURRNT Veterans Wildomar South, LLC – Approved - 10/01/2020 o (Retail) – Project PA20-0084 o 32475 Clinton Keith Rd., Wildomar, CA, 92595 5. CURRNT Veterans Wildomar North, LLC – Approved - 10/01/2020 o (Retail) – Project PA 20-0085 o 14 Bundy Canyon Rd., Wildomar, CA, 92595 Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 19 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.13 General Counsel – Lance Rogers Lance Rogers will serve as General Counsel for Current Cannabis. He is the Principal / Attorney at Law Offices of Lance Rogers in San Diego, California.1 As a part of his regulatory compliance practice, he currently represents many of the leading cannabis and hemp companies in California, including retailers, manufacturers, and agriculture ventures. As a litigator, he has handled a wide array of matters related to cannabis including criminal defense, regulatory violations, land use/zoning, complex business litigation and partnership, and dispute matters. In 2011, Mr. Rogers assisted his client to obtain the first dispensary license in Southern California through the County of San Diego. From 2014-2015, he worked with clients to obtain commercial cannabis licenses in the cities of San Diego, Santa Ana, Desert Hot Springs, and Adelanto. From 2015 to 2016, he worked with numerous cannabis farmers in Northern California on corporate compliance and licensing projects including the formation of the first cannabis agricultural cooperative in California. From 2017-2018, he worked on commercial cannabis facilities in Humboldt, Mendocino, Oakland, Costa Mesa, San Bernardino, and Long Beach. His team is currently working on licensing projects in Humboldt, San Bernardino, Palm Springs, Oceanside, King City, Chula Vista, and Los Angeles. Mr. Rogers has written extensively about the cannabis and hemp industries and is a frequent speaker at legal conferences across the United States, including San Diego Americans for Safe Access (2009); Legal Cannabis Institute (2010); San Diego Public Defender (2011); San Diego County Bar Association (2012); NORML Legal Conference, Colorado (2013); Thomas Jefferson School of Law (2014, 2016, 2019); Professional Fiduciary Association of California (2014); North County Bar Association (2014, 2015), Cannabis Grand Cru, Colorado (2014), California Bar Association, Intellectual Property Section (2015), Students for Sensible Drug Policy (2015), UC Irvine Drug Symposium (2015), Orange County Bar Association, Labor & Employment Section (2015, 2016, 2018), Ganjier Seed Festival (2016), Cannabis World Congress & Business Exposition (2016, 2017), the National Cannabis Industry Association (2017), Paradigm Cannabis (2018), National Business Institute (2018, 2019), Rossdale CLE (2019, 2020), and UCSD Skaggs School of Pharmacy. From 2013-2014, Mr. Rogers served as General Counsel for the California Cannabis Industry Association, a state industry group he helped to form. His peers have nominated him as a “Rising Star” in Super Lawyer magazine six times in a row (2015-2020). 1 https://lrogerslaw.com/ Section: Business Plan Subsection: 1.1 Owner Qualifications Applicant: Community Veterans of Fresno Page 20 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.1.14 Charlena Berry - Cannabis Business Consultant Charlena Berry serves as a domestic and international consultant assisting new companies gain entrance into the cannabis industry.2 CEO of Cannabis Business Growth, Char holds a Master of Science in Supply Chain Management from Michigan State University and has more than 12 years’ experience working for Fortune 500 companies in the manufacturing (Whirlpool Corporation) and retail sectors (Office Depot/Office Max). Working in 26 of the 33 legal states, Charlena has spent the last 4 years working with cannabis start-ups to gain licensure. She has drafted business plans and cannabis license applications for Cultivators, Manufacturer’s, Storefront and Non-Storefront Retails, and Test Laboratories. With this experience, she guides these companies through industry best practices for planning, fiscal compliance, and operational strategy. Overseeing projects that range from $300K to more the $15M, she is regarded by her peers as an industry expert that consults clients on cannabis industry best practices. This includes selecting the best seed to sale and POS Systems to ensure systemic compliance to rules outlined by regulatory bodies. She also consults on business entity formation, accounting practices, and company operations. She is regarded by her clients as a go-to with a wealth of experience to share. In the California market, she boasts winning licenses for clients in the municipalities of Chula Vista (non- storefront delivery and retail), Riverside County (2 retail), Commerce (non-storefront delivery), Long Beach (micro-business), Montebello (non-storefront delivery, micro-business), Sacramento (micro-business), Nevada City (non-volatile manufacturing), Seaside (storefront retailer), San Bernardino (2 micro-business), Vista (retailer), and Moreno Valley (storefront retailer). Additionally, Char is an expert in the California Regulatory Framework and is working on more than a dozen state applications. A native to the State of Michigan, she has also partnered with clients to obtain licensing for clients in the cities of Muskegon Heights (cultivation & processing), Niles (retail), Harvest Park (cultivation), Hartford (retail) and Lansing (secure transport). In Michigan, working as a patient advocate, she has also spoken to local city councils on a number of occasions about legalizing cannabis in their city to help dispel the myths associated with cannabis. Concerned for social justice, Char offers reduced consulting rates for Social Equity applicants. To further diversify her portfolio, Char has worked internationally with licensing projects in the new recreational Canadian markets of the Northwest Territory, British Columbia, Saskatchewan, and Ontario. She has also done procedural consulting for medical applicants in Australia. Finally, Char loves helping clients achieve their start-up goals in the cannabis industry. When engaging a client, she’s working to create a client and ultimately a friend for life. For each project she spearheads, she tackles it with 200% to ensure she is crafting a strategy which wins cannabis licenses. 2 https://www.cannabisbusinessgrowth.com/ Section: Business Plan Subsection: Budget for Construction and Operational Costs Applicant: Community Veterans of Fresno Page 21 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: Budget for Construction and Operational Costs Applicant: Community Veterans of Fresno Page 22 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: Budget for Construction and Operational Costs Applicant: Community Veterans of Fresno Page 23 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: Budget for Construction and Operational Costs Applicant: Community Veterans of Fresno Page 24 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: Budget for Construction and Operational Costs Applicant: Community Veterans of Fresno Page 25 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: Budget for Construction and Operational Costs Applicant: Community Veterans of Fresno Page 26 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Estimate of Excise Tax Collected Section: Business Plan Subsection: Budget for Construction and Operational Costs Applicant: Community Veterans of Fresno Page 27 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Business Plan Subsection: Proof of Capitalization Applicant: Community Veterans of Fresno Page 28 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.3 PROOF OF CAPITALIZATION Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 37 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.6 DAILY OPERATIONS The following is a summary of the Community Veterans of Fresno’s day-to-day operations: 1. Following security checks, transportation vehicles of distributors approach the Facility. 2. Distribution personnel enter the Facility’s intake / outflow area and Community Veterans of Fresno’s employee’s offload cannabis goods. 3. After verifying that cannabis goods have passed the quality assurance and inspection procedures and been issued a certificate of analysis pursuant to Section 26110 of the State Business & Professions Code, Community Veterans of Fresno’s employee’s stage the cannabis goods for display on the sale floor and retail sale via delivery vehicles or the sales floor. 4. Community Veterans of Fresno’s employees transfer assembled and processed orders of cannabis goods to delivery drivers for loading into delivery vehicles by Community Veterans of Fresno’s delivery drivers. 5. Customers enter the Facility via the customer intake and verification area, and Community Veterans of Fresno’s employees verify the status of customers. 6. Validated customers enter the sales floor and (i) interact with Community Veterans of Fresno’s employees, (ii) observe securely displayed cannabis goods, and (iii) have limited and/or supervised interaction (touching, smelling, etc.) with securely displayed cannabis goods. 7. Validated customers purchase and take possession of processed orders of cannabis goods or (ii) return cannabis goods that may be adulterated. 8. After finishing their business purpose for visiting the Facility, customers are securely allowed to exit the Facility by Community Veterans of Fresno’s employees. 1.6.1 Customer Check-In Procedures Pursuant to FMC 9-3309(i), Community Veterans of Fresno will not allow any person under 21 years of age access to the dispensary, unless the person is 18 years of age or older and possesses a valid government-issued identification card and either a valid county-issued identification card under Section 11362. 712 of the California Health and Safety Code, or who is a qualified patient in possession of a valid physician's recommendation in their name, or who is a primary caregiver for a person in possession of a valid physician's recommendation. In accordance with FMC 9-3309(i)(2), the entrance to Community Veterans of Fresno’s facility will be clearly and legibly posted with a notice that no person under the age of 21 is permitted to enter the premises. Pursuant to FMC 9-3310(a)(4), entrances into the facility will be locked at all times with entry strictly controlled. A "buzz-in" electronic/mechanical entry system will be utilized to limit access and entry to the retail area to separate it from the reception/lobby area. Before a customer is introduced to cannabis products, they must have their identification verified. An employee of Community Veterans of Fresno will verify the age and all necessary documentation of each individual to ensure customers are not under the age of twenty-one (21) years or at least 18 years of age and possesses a valid physician’s recommendation after confirming the customer’s age, identity, and physician’s recommendation. Customers will be asked to produce one of the following forms of acceptable identification pursuant to 16 CCR § 5404(c): • A document issued by a federal, state, county, or municipal government, or a political subdivision or agency thereof, including, but not limited to, a valid motor vehicle operator's license, that contains the name, date of birth, physical description, and a photo of the person; • A valid identification card issued to a member of the Armed Forces that includes a date of birth and a photo of the person; or • A valid passport issued by the United States or by a foreign government. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 38 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Once a customer has been verified with the acceptable form of identification, they will be granted access to the sales floor and begin the product discovery and sales process. Community Veterans of Fresno will maintain records of the following information for each member and customer of the dispensary that purchases medical cannabis: 1. The name, date of birth, physical address, and telephone number; and their status as a qualified patient or primary caregiver. 2. A copy of each qualified patient's written physician recommendation and their designation of a primary caregiver. These records will be maintained by Community Veterans of Fresno for a period of not less than three years and will be produced to the city within 24 hours after receipt of the City's request. Further, Community Veterans of Fresno will report any loss, damage, or destruction of these records to the Police Chief within 24 hours of the loss, damage, or destruction. Customer Waiting Area Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 39 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.6.2 Procedures for Receiving Deliveries During Business Hours Conformance with State Testing Pursuant to 16 CCR § 5302, it is the responsibility of the licensed distributor to ensure that cannabis product has been tested. Community Veterans of Fresno is committed to maintaining adequate storage and sanitary storage procedures for usable cannabis products. To protect the quality of product, Community Veterans of Fresno will conduct an inspection upon receipt to ensure that testing has been complete, products are properly packaged, and are accompanied by certified approval from a licensed testing facility. Any products missing testing results will be refused at time of delivery. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 40 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Packaging Guidelines Community Veterans of Fresno will ensure all cannabis, cannabis products, and cannabis accessories sold by Community Veterans of Fresno will be packaged, labeled and placed in tamper-evident packaging which at least meets the requirements of the MAUCRSA and all state implementing rules and regulations. As a retailer, Community Veterans of Fresno will not package or label cannabis goods or accept, possess, or sell cannabis goods that are not packaged as they would be for final sale pursuant to 16 CCR § 5412. In accordance with 16 CCR § 5406, Community Veterans of Fresno will not make any cannabis goods available for sale to a customer unless: 1. The cannabis goods were received from a licensed distributor or licensed microbusiness authorized to engage in distribution; 2. Community Veterans of Fresno has verified that the cannabis goods have not exceeded their best-by, sell- by, or expiration date if one is provided; 3. In the case of manufactured cannabis products, the product complies with all requirements of Business and Professions Code section 26130 and California Code of Regulations, Title 3, Division 8 and Title 17, Division 1, Chapter 13; 4. The cannabis goods have undergone laboratory testing as required by local and state law; 5. The batch number is labeled on the package of cannabis goods and matches the batch number on the corresponding certificate of analysis for regulatory compliance testing; and 6. The packaging and labeling of the cannabis goods complies with Business and Professions Code Section 26120 and all applicable regulations. Community Veterans of Fresno’s Inventory Control Agent will regularly review the state guidelines to ensure all cannabis products are packaged in accordance with the rules set forth by the BCC. If the products are not packaged to standards, the distributor will be contacted to coordinate a return. To ensure compliance with these regulations, Community Veterans of Fresno will print and laminate the packaging requirements and keep it in the receiving bay for regular reference for the Inventory Control Agent. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 41 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Recording Incoming Inventory In accordance with 16 CCR § § 5049(a), once inventory has passed complete inspection for all packaging and labeling requirements and is deemed compliant and acceptable, all incoming inventory will be scanned into Community Veterans of Fresno’s COVA Inventory Management System and the State Track and Trace System. The Inventory Control Specialist will physically count and scan each cannabis product into inventory, capturing all product details electronically pursuant to 16 CCR § 5049(b), including, but not limited to, the following: 1 Name and type of the cannabis goods. 2 Unique identifier of the cannabis goods. 3 Amount of the cannabis goods, by weight or count, and total wholesale cost of the cannabis goods, as applicable. 4 Date and time of the activity or transaction. 5 Name and license number of other licensees involved in the activity or transaction, including: a. The name, license number, and licensed premises address of the originating licensee. b. The name, license number, and licensed premises address of the licensee transporting the cannabis goods. c. The name, license number, and licensed premises address of the destination licensee receiving the cannabis goods into inventory or storage. d. The date and time of departure from the licensed premises and approximate date and time of departure from each subsequent licensed premises, if any. e. Arrival date and estimated time of arrival at each licensed premises. f. Driver license number of the personnel transporting the cannabis goods, and the make, model, and license plate number of the vehicle used for transport. The Inventory Control Specialist will compare the shipping manifest and the physical inventory with the purchase order on file and scan all products listed on the purchase order. This process eliminates errors in receiving inventory eliminating unaccounted shortages or overages in inventory. Below is an example of system generated purchase orders and the process of receiving inventory into the COVA system. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 42 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Product Storage Community Veterans of Fresno will ensure all cannabis and cannabis products are stored in a secured and locked room, safe, or vault. All safes and vaults will be compliant with Underwriter Laboratories burglary- resistant and fire- resistant standards. All cannabis and cannabis products, including live clone plants that are being displayed for sale, will be kept in a manner as to prevent diversion, theft, and loss. In compliance with FMC 9-3309(d), Community Veterans of Fresno will not store cannabis or cannabis products outdoor at any time. 1.6.3 Point-of-Sale System and the Number of Point-of-Sale Locations In full compliance with FMC 9-3309(e), Community Veterans of Fresno will have in place a point-of-sale or management inventory tracking system to track and report on all aspects of the business including, but not limited to, such matters as cannabis tracking, inventory data, gross sales (by weight and by sale) and other information which may be deemed necessary by the city. Community Veterans of Fresno will ensure that such information is compatible with the city's record-keeping systems and be approved and authorized by the City Manager or his/her designee(s) prior to being used by the permittee. Additionally, the system will have the capability to produce historical transactional data for review. Community Veterans of Fresno’s tracking system is compliant with the state's designated track-and-trace system METRC. Community Veterans of Fresno will ensure that such information is compatible with the City's record- keeping systems. Additionally, the system has the capability to produce historical transactional data for review. Pursuant to FMC 9-3331(c), Community Veterans of Fresno will maintain an inventory control and reporting system that accurately documents the present location, amounts, and descriptions of all cannabis and cannabis products for all stages of the growing and production or manufacturing, laboratory testing and distribution processes in accordance with the MAUCRSA. Community Veterans of Fresno will use the COVA Cannabis Dispensary POS system to record and report on all aspects of cannabis tracking, inventory data, and gross sales. This will serve as a legally compliant seed to sale Point of Sale system. COVA is an authoritative leader in seed to sale best practices cannabis compliant point of sale systems, Cova’s systems integrates into the states regulatory reporting and tracking system METRC. Cova is embraced here in California by other licensed cannabis seed to sale compliant retailers and in other jurisdictions such as Oklahoma and Canada. COVA will prevent staff from breaking the rules or making operational missteps that violate local and state regulations. COVA includes an Age Verification Scanner in order to prevent underage sales and to verify information with ID barcode scanners. COVA also includes a Purchase Limits Alert feature where it automatically calculates product equivalencies that would violate state regulations. If it is violated, it will alert the staff that limits have been exceeded. Finally, the COVA software makes it impossible to serve patrons after the allowed Hours of Operation. This will ensure that Community Veterans of Fresno complies to the authorized hours of operation. COVA also is an inventory tracking system. The system will track and report all aspects of Community Veterans of Fresno’s cannabis business including, but not limited to, such matters as inventory data, gross sales (by weight and by sale), and other information which may be deemed necessary by the City. Community Veterans of Fresno’s business shall ensure that such information is compatible with the City’s record-keeping systems. In addition, the system will have the capability to produce historical transactional data for review. Community Veterans of Fresno will ensure all scales and weighing mechanisms used to weigh non-waste products will be able to weigh to within 1/100th of a gram, will be maintained in good working order, and available for annual inspection should the City or State office deem it necessary. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 43 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 POS Equipment Community Veterans of Fresno will be purchasing the below equipment to support retail operations.3 Track-and-Trace Standard operating procedures include detailed California Cannabis Track-and- Trace (CCTT) procedures as outlined by the State. Track and Trace Account Manager Pursuant to 16 CCR § 5048, Community Veterans of Fresno will designate one individual to own the management of the track and trace system. This individual may authorize other owners or employees as track and trace system users and shall ensure that all users are trained on the track and trace system prior to use. The Track and Trace Account Manager will adhere to the following rules: 1. The account manager shall attend and successfully complete all required track and trace system training, including any orientation and continuing education. 2. If the account manager did not complete the required track and trace system training prior to receiving their annual license, the account manager shall sign up for and complete state mandated training, as prescribed by the Bureau, within 10 business days of license issuance. 3. The account manager and each user shall be assigned a unique log-on, consisting of a username and password. The account manager or each user accessing the track and trace system shall only do so under his or her assigned log-on and shall not use or access a log-on of any other individual. No account manager or user shall share or transfer his or her log-on, username, or password, to be used by any other individual for any reason. 4. The account manager shall maintain a complete, accurate, and up-to-date list of all track and trace system users, consisting of their full names and usernames. 5. A licensee shall monitor all compliance notifications from the track and trace system, and timely resolve the issues detailed in the compliance notification. 6. The track and trace account manager will be responsible for training Shift managers, Retail Sales Associates, and Inventory Control Agents. 3 Detailed specs can be found here: https://www.covasoftware.com/hardware/us/pos Tablets Barcode Scanners Cash Drawers Label Printers Mounts & Stands Receipt Printers Scales Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 44 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Mandated Bi-Weekly Inventories Pursuant to 16 CCR § 5051(a), at intervals not exceeding 14 days, the Inventory Control Agent will conduct and document an audit of the inventory that is accounted for according to generally accepted accounting principles. Any unexplained shrinkage will be documented and trigger a review of electronic security and surveillance data. When Community Veterans of Fresno determines where the shrinkage occurred, appropriate corrective measures will be implemented. Law enforcement authorities will be notified immediately if the Inventory Control Agent ascertains that there has indeed been loss, theft, improper diversion, or any other criminal activity. Opening and Closing Inventories Employees will regularly conduct an inventory of all products. 1. A comprehensive inventory of all cannabis will be done twice daily: a. Before the retailer opens; and b. After close of daily operations. 2. All cannabis and items containing cannabis are counted, weighed, or both. 3. Inventory results will be submitted to the Inventory Control Agent for reconciliation with the inventory data generated the previous evening or in the operations of the day after being closed out. 4. Discrepancies will trigger an inventory audit by the Inventory Control Agent and, if confirmed, a review of electronic security and surveillance data. 5. Law enforcement authorities will be notified immediately if the Inventory Control Agent ascertains that there has indeed been loss, theft, improper diversion, or any other criminal activity. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 45 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Notification of Theft, Loss, and Criminal Activity Pursuant to FMC 9-3310(b)(5) and 16 CCR § 5051(b), Community Veterans of Fresno will notify the City Manager or his/her designee(s), the Bureau of Cannabis Control, and local law enforcement within 24 hours of discovery of any of the following situations: 1. The licensee discovers a significant inventory discrepancy. a. A significant discrepancy in inventory means a difference in actual inventory compared to records pertaining to inventory of at least $5,000 or 2 percent of the average monthly sales of the licensee, whichever is less. 2. The licensee discovers theft, loss, or any other criminal activity pertaining to the operations of the licensee. 3. The licensee discovers theft, loss, or any other criminal activity by an agent or employee of the licensee pertaining to the operations of the licensee. 4. The licensee discovers loss or unauthorized alteration of records related to cannabis goods, clients, or the licensee’s employees or agents. 5. The licensee discovers any other breach of security. In the case that one of the activities above is discovered by the licensee, the licensee will follow the below procedure. 1. Notify local law enforcement. 2. Record the date and time of the loss. 3. Record a description of the incident and where applicable the items that were taken or lost. Recordkeeping Pursuant to FMC 9-3331(a), Community Veterans of Fresno will maintain accurate books and records in an electronic format specified in Fresno Municipal Code as well as the § 16 of the MAUCRSA and will make the same available for inspection and examination of the local licensing authority or its duly authorized representatives during standard business hours of the licensed facility or at any other reasonable time. As specified by 16 CCR § 5037(a), Community Veterans of Fresno will exercise due diligence in preserving and maintaining all following records related to its commercial cannabis activity for at least seven years: • Financial records including, but not limited to, bank statements, sales invoices, receipts, tax records, and all records required by the California Department of Tax and Fee Administration (formerly Board of Equalization) under title 18, California Code of Regulations, sections 1698 and 4901, detailing all of the revenues and expenses of the business, and all of its assets and liabilities. • Personnel records, including each employee’s full name, social security or individual taxpayer identification number, date employment begins, and date of termination of employment if applicable. (Training records including, but not limited to, the content of the training provided and the names of the employees that received the training. • Contracts with other licensees regarding commercial cannabis activity. • Permits, licenses, and other local authorizations to conduct the licensee’s commercial cannabis activity. • Security records, except for surveillance recordings required pursuant to section 5044 of this division. • Records relating to the composting or destruction of cannabis goods. • Documentation for data or information entered into the track and trace system. • All other documents prepared or executed by an owner or his employees or assignees in connection with the licensed commercial cannabis business. On no less than an annual basis (at or before the time of the renewal of a commercial cannabis business permit issued pursuant to this Article), or at any time upon reasonable request of the city, Community Veterans of Fresno will file a sworn statement detailing the number of sales by the commercial cannabis business or cannabis retail business during the previous twelve-month period (or shorter period based upon the timing of the request), provided on a per-month basis. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 46 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 The statement will also include gross sales for each month, and all applicable taxes paid or due to be paid. On an annual basis, Community Veterans of Fresno will submit to the city a financial audit of the business's operations conducted by an independent certified public accountant. Community Veterans of Fresno will also maintain a current register of the names and the contact information (including the name, address, and telephone number) of anyone owning or holding an interest in Community Veterans of Fresno’s Business, and separately of all the officers, managers, employees, agents and volunteers currently employed or otherwise engaged by Community Veterans of Fresno. Records will be provided to the City Manager or his/her designee(s) upon a reasonable request in accordance with FMC 9-3331(b). Finally, and in compliance with FMC 9-3331(d), subject to any restrictions under the Health Insurance Portability and Accountability Act (HIPAA) regulations, Community Veterans of Fresno will allow the city to have access to the business's books, records, accounts, together with any other data or documents relevant to its permitted commercial cannabis activities, for the purpose of conducting an audit or examination. Books, records, accounts, and any and all relevant data or documents will be produced no later than twenty-four (24) hours after receipt of the city's request, unless otherwise stipulated by the city. Community Veterans of Fresno will provide requested materials in an electronic format that is compatible with the city's software and hardware. Below is an example of activity reports that can be directly generated in the COVA Inventory Management system. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 47 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Point of Sale Locations The company has identified 7 Point of Sale locations on the dispensary sales floor. Each POS location will be monitored by 4k surveillance cameras with clear view of the transaction area. Footage will capture all actions throughout the transaction from behind the sales counter. Image of the proposed sales floor. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 48 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.6.4 Estimated Number of Customers to be Served per Hour/Day Community Veterans of Fresno, again, has extensive experience in managing cannabis facilities, especially, retail facilities. This has given them an advantage in understanding potential volume and all the factors that may impact daily traffic. In the preparation of the pro forma, the Community Veterans of Fresno team did estimate daily customer counts and transactions and took these factors into consideration not only in facility design but also in security and personnel planning. While the estimated per day volumes are expected to peak at certain times of the day such as during mid-morning and early evening hours, the aggregate daily traffic estimated for the first year is listed below. Visitors per Day 208 Average Transactions per Hour 18.8 Based on some research and the traffic experienced at other retail facilities previously managed by the owners, the team further projected volume by the hour, again, accounting for peak times. According to research released recently by Headset, a Seattle-based business intelligence and analytics service for the cannabis industry, unsurprisingly Fridays and Saturdays tend to be the busiest days of the week, however, when broke down hourly, it was found that nearly 50% of the daily traffic is seen after 5 pm.4 This study was not surprising to the Community Veterans of Fresno team, and mimicked similar trends seen in previous experiences. This trend accounts for the fact that many shoppers hold a 9am-5pm workday and choose to shop at the conclusion of their daily routine. As shown above, Community Veterans of Fresno expects transactions per hour to gradually increase throughout the day. Community Veterans of Fresno plans to have at least 5 Retail Sales Associates working during peak business hours. With 5 associates and POS stations, Community Veterans of Fresno projects that each associate will handle approximately 6 transactions per hour. For security and safety precautions, Community Veterans of Fresno will not allow more than 2 customers, per sales associate into the retail sales area at one time. This will enable the Retail Sales Associates to feel comfortable with monitoring activities without impeding their ability to provide the customer with the level of service and attention that the company seeks to. 4 https://thefreshtoast.com/cannabis/youll-never-guess-the-best-time-to-buy-legal-marijuana/ 17 21 25 31 52 62 0 20 40 60 80 9 am - 11am 11 am - 1 pm 1 pm - 3 pm 3 pm - 5 pm 5 pm - 7 pm 7 pm - 9 pm Operating Hours ESTIMATE OF CUSTOMERS BY OPERATING HOURS Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 49 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.6.5 Proposed Product Line Based on the experience of the company’s President and CEO, Daniel Wise, Community Veterans of Fresno will sell popular cannabis products that evolve with changes in the market. This includes variations of the following Adult Use and Medical Cannabis products: Product Estimate % of Sales Description Prepacked Flower 40.34% Raw Cannabis Flower remains the most popular product. Community Veterans of Fresno will sell a mix of different strains depending on client demand and work to procure craft strains from the best cultivators in California. Vaporizing Cartridges 23.01% Cannabis vaporization is growing in popularity among people interested in consuming cannabis in an easy, discreet manner that’s healthier than traditional smoking methods. Community Veterans of Fresno will carefully select vendors who do not use Vitamin E in their oil. Pre-Rolls 11.02% Community Veterans of Fresno will sell pre-rolled cannabis in individuals and packs. The smaller size allows individuals to purchase cannabis in smaller quantities. Edibles 10.04% Community Veterans of Fresno will sell a small quantity of edibles within the store and provide information on careful micro-dosing. If the demand appears to increase on edibles, Community Veterans of Fresno will expand product lines. Tinctures 1.21% Community Veterans of Fresno will offer a small amount of select tinctures in the facility. A cannabis tincture is a cannabis- based extract that is infused with alcohol. This product provides easy dosing for clients with rapid absorption. This line is designed to appeal to individuals who do not want to smoke, vape, or eat cannabis products. Topical 0.58% Community Veterans of Fresno will offer cannabis infused spray and lotions for patrons who are arthritic or have aching injuries. Batteries 0.53% To support our vaporizing cartridges, Community Veterans of Fresno will sell rechargeable vaporizer batteries. Capsules 1.18% While less popular with users, capsules are a simple way to accurately dose and easily consume cannabis oils. Taken like a vitamin, capsules enter the digestive tract, where they are broken down and the cannabinoids contained within are released. Drinks 0.22% Community Veterans of Fresno will carry a small assortment of cannabis infused drinks. Depending on the season, this may include tea, soda, or cider. Community Veterans of Fresno will carefully review packing on these beverages to ensure compliance and instructions for micro dosing. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 50 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Prohibited Products Community Veterans of Fresno will not sell any expired products, cannabis, or cannabis products. Community Veterans of Fresno will not, under any circumstance alter, edit, or adjust in any manner an expiration date on any item or product once affixed by its manufacturer. In strict compliance with 16 CCR § 5408, Community Veterans of Fresno will not grow or cultivate cannabis, except for immature nursery stock cannabis plants, on the dispensary site. Pursuant to 16 CCR § 5406(a), all cannabis and cannabis products sold or distributed by Community Veterans of Fresno will be cultivated, manufactured, and transported by licensed facilities that maintain operations in full conformance with State and local regulations. In strict compliance with FMC 9-3309(b)(c), Community Veterans of Fresno will not cause or permit the sale, dispensing, or consumption of alcoholic beverages or tobacco products on or about the premises of the cannabis retail facility. Retail Sales Policies In strict compliance with 16 CCR § 5025(c), Community Veterans of Fresno will only serve customers who are within the licensed premises, or at a delivery address that meets the following requirements: 1. Sale or delivery of cannabis goods through a pass-through window or a slide- out tray to the exterior of the premises is prohibited. 2. Retailers shall not operate a drive- in or drive- through. Cannabis goods shall not be sold and/ or delivered to any persons within a motor vehicle. 3. All cannabis goods sold by a retail business shall be contained in child- resistant packaging. 4. Point- of-sale areas and areas where cannabis goods are displayed for sale shall be recorded on the video surveillance system. At each paint-of-sale location, camera placement must allow for the recording of the facial features of any person purchasing or selling cannabis goods, or any person in the retail area, with sufficient clarity to determine identity. 5. Retailers shall hire or contract for security personnel who are at least 21 years of age to provide security services for the retail premises. All security personnel hired or contracted for by the permittee shall be licensed by the Bureau of Security and Investigative Services and shall comply with Chapters 11. 4 and 11. 5 of Division 3 of the Business and Professions Code. No person in association with Community Veterans of Fresno’s business will give, sell, distribute, or otherwise transfer any cannabis to any person in any manner that violates local or state law. Medical Retail Policies Pursuant to 16 CCR 5404(b), Community Veterans of Fresno will restrict the sale of medical cannabis only to: 1. A person 18 years of age or older who possesses a valid government-issued identification card and a valid county-issued identification card under Section 11362. 712 of the California Health and Safety Code; or 2. Qualified patients with a currently valid physician's recommendation in compliance with the Compassionate Use Act of 1996 (California Health and Safety Code section 11362.5), the Medical Marijuana Program Act (California Health and Safety Code section 11362.7 et seq.), and valid government- issued identification such as a Department of Motor Vehicles driver's license or State Identification Card; or 3. Primary caregivers with a verified primary caregiver designation by their qualified patients, a copy of their qualified patient's valid physician's recommendation in compliance with the Compassionate Use Act of 1996 (California Health and Safety Code section 11362.5), the Medical Marijuana Program Act (California Health and Safety Code section 11362.7 et seq.), and valid official identification such as a Department of Motor Vehicles driver's license or State Identification Card. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 51 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 In accordance with FMC 9-3310(a)(2), Community Veterans of Fresno asserts there will not be a physician located on the premises at any time for the purpose of evaluating patients for the issuance of a cannabis recommendation or card where applicable. Purchase Limits Pursuant to 16 CCR § 5409(a)(b), an associate will be responsible for ensuring that the customer does not exceed the daily purchase limits. Limits will be monitored for both adult-use and medical patients adhering to the following state mandates: Adult-Use Purchase Limits • 28.5 grams of non-concentrated cannabis. • 8 grams of concentrated cannabis as defined in Business and Professions Code section 26001, including concentrated cannabis contained in cannabis products. • 6 immature cannabis plants. Medical Purchase Limits • 8 ounces of medicinal cannabis in the form of dried mature flowers or the plant conversion as provided in Health and Safety Code section 11362.77. The COVA Inventory Management and Point-of-Sale System will help employees monitor and adhere to purchase limits. Each transaction will be conducted under a unique customer profile that will log daily purchases. The system further captures what type of customer it is, medical or adult use, which will look for preset purchase limits based on customer type. Should a customer exceed the purchase limit, the system will notify the sales associate and not allow the transaction to be finalized until the overages are corrected. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 52 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Customer Interaction Upon verification of the customers age and the customer entering the sales floor area, the customer will have access to view products that are locked in display cases. Customers will be greeted by a Retail Sales Associate who will ask the customer if they have any questions about the various products. All associates will be identified with their company issued uniform, a branded polo shirt. If the customer replies yes, the Retail Sales Associate will use his/her training to answer questions and educate the customer on the different product types, consumption methods, and strains. Customer will not be able to handle product in the discovery phase. Sample products will he handled by Retail Sales Associates only and cannabis products within the store will never be opened. Once a customer has decided on their purchase, the requested products will be “checked-into” staging areas by systemic notations in the Inventory Management System by the Retail Sales Associate. It is the commitment of Community Veterans of Fresno to maintain accurate Inventory Management records, therefore at any given moment in time, Community Veterans of Fresno will be able to provide a “real-time” report of the cannabis quantities in storage which can be provided to the Department upon request. The Retail Sales Associate will retrieve desired products from the staging area (daytime storage area) and scan the products at the point of sale station under the surveillance. Employees who handle cannabis product in order to transfer that product to customers will be required to check in and take responsibility for the product they are handling systematically within in the Inventory Management System. Managers will monitor and approve the access that employees have to areas where cannabis is stored. As the Retail Sales Associate scans each product being purchased, products will be placed in a bag. Upon completion of the transaction, the drawstring bag will be sealed in a childproof exit bag and handed to the customer. The customer will be escorted out of the sales area by the Retail Sales Associate and will pleasantly conclude the customer’s shopping experience. Company Uniform For ease to the Retail Associates and Security Staff, Community Veterans of Fresno will require each member of the team wear a company issued uniform. The uniforms will aid staff in visually differentiating between customers and staff members and help them identify quickly if customers are close to a restricted area for any reason. The uniforms will further aid law enforcement or management who may need to review video surveillance in quickly identifying staff members in their observations. Company uniforms will include the company logo and each team member will be provided attire prior to the start of work duties. Customer Product Handling Procedures Community Veterans of Fresno’s product storage plan is designed with the safety and security of the facility and employees in mind. The plan consists of physical barriers to prevent theft and diversion, operational barriers that limits the minimum number of authorized individuals to gain access to any cannabis products, and environmental controls that prevent the deterioration of cannabis products. Pursuant to 16 CCR § 5033(a), all cannabis and cannabis products will be stored in a secured and locked vault or vault equivalent. All safes and vaults will be compliant with Underwriter Laboratories burglary- resistant and fire- resistant standards. All cannabis and cannabis products, including live clone plants that are being displayed for sale, will be kept in a manner as to prevent diversion, theft, and loss. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 53 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 In strict compliance with FMC 9-3310(a)(5), only the quantity of cannabis and cannabis products necessary to meet the daily demand will be readily available for sale on-site in the retail sales area. To further ensure customers do not have access to cannabis products, Community Veterans of Fresno will implement the use of physical barriers (walls and doors), electronic measures and employee procedures in order to deter and prevent the unauthorized entrance into areas containing cannabis or cannabis products, and to deter and prevent the theft of cannabis or cannabis products at the commercial cannabis business. All points of access to the business will be controlled with electronic access controls, keypads, key cards, and remote electronic lock (buzz-in) features. Individuals who are not engaging in an activity related to the permitted operations of the commercial cannabis business will not be allowed to remain on the premises. Customer Education Customers are key to any business. Without customers, businesses cannot survive. In the cannabis industry ensuring that customers understand products, the various methods of consumption, potency and the potential effects is particularly important not only for sales but for safety. At Community Veterans of Fresno’s facility, customer education will begin as soon as a customer encounters their first sales associate. Community Veterans of Fresno has developed a proprietary Employee Product Education Program that will give the employees the tools to speak to customers about cannabis strains, consumption methods, warnings, micro dosing, and health benefits. Throughout the facility, retail sales associates will be present to answer questions and to educate customers on the individual benefits of the cannabis psychoactive and non-psychoactive products, how to interpret percentages of THC/CBD, and the different methods of consumption. The staff will undergo training from Cannabis Training University in order to communicate with customers the effective way of how to properly dose oneself from any method chosen. Process to Educate Customers Community Veterans of Fresno also believes it is important to empower customers to learn more about cannabis strains, products, and effects in ways that are most comfortable for them. Therefore, Community Veterans of Fresno has created multiple channels in which customers can receive information about cannabis, they include: • Printed marketing collateral with information that can be read at home. • Tools that customers can use at home to monitor usage to avoid overconsumption and track the results of their cannabis experience. • Online videos and information shared through social media outlets including Facebook, Instagram, and YouTube. • A series of educational blogs designed to educate the consumer. The printed marketing material will include a series of customer information cards printed on 4x6 cards that will provide easy to read information for the customer reviewing cannabis products. The cards will contain information regarding potency information, strain information, effects of excess usage, methods of consumption, and avoiding over consumption. These cards will be strategically placed throughout the facility for easy reference for customers. Some, including information on risks and side effects, will be provided to each customer upon purchase. Community Veterans of Fresno has also developed tools for customer to use on their own to help them monitor their usage and track their cannabis experience with various products. The strain selection guide and cannabis usage journal will enable customers to pro-actively determine what strains may be right for them based on their desired effects and track their personal experience with various products they have tried and narrow in on what products, strains, and dosing works best for them. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 54 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Education on Consumption Methods Throughout the facility, sales associates will be present to answer questions and to educate customers on the benefits of cannabis psychoactive and non-psychoactive products, the percentages of THC/CBD. This will extend to explaining the different strains available as well as the difference between the two major strains: Sativa and Indica. Associates will also explain the different products and consumption methods which include: • Smoking cannabis flower • Vaporizing • Ingesting edibles • Topicals Each method of ingestion has a different administration process and a different effect on the body and mind. Most consumers prefer a discrete method of consumption, such as vaporizing or using a topical. The good news is, there are numerous products to choose from and everyone finds what works best. While the sales associate’s explanation and assistance will help the customers determine which consumption method is best suited for their specific needs, informational cards will also be available for customers to read on their own or take home. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 55 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Education on Potency and Avoiding Overconsumption Each person is unique and reacts to medications and chemicals in their own way. The same goes for cannabis use as each person has their own personal tolerances. People are often surprised to learn that the therapeutic effects of cannabis can be achieved at a dosing that does not create a feeling of euphoria or “high” that sometimes accompanies consumption. Accurate dosing can help a person achieve the therapeutic benefits without the unwanted feelings. Community Veterans of Fresno created a dosing card to help customers understand dosing and the duration of effects to help educate those new to cannabis products and to help warn customers of overconsumption. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 56 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Customer Warnings and Risks Customers will also receive information on risks that can be associated with cannabis use. Additionally, the customer will be educated on the importance of keeping the cannabis and cannabis products out of the reach of children. Community Veterans of Fresno has created the below informational cards listing all possible side effects and the short and long-term effects of excess cannabis use. Understanding the importance of this information, to ensure this information reaches customers, Community Veterans of Fresno will provide these cards to each customer upon purchase. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 57 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Education on Cannabis Variety - Customer Education Cards Community Veterans of Fresno will make available a series of strain spotlight cards that will be available to customers. These cards will feature specific strains and provide a quick, easy to read overview of a strain. The information cards will include strain profile information, originating strains and most commonly experienced effects of the strain. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 58 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Strain Selection Guide Employees can use the Strain Selection Guide to help a customer decide the type of cannabis product or variety they are searching for. Additionally, this form can be taken home for the customer to evaluate strain selection at home. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 59 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Cannabis Usage Journal This Cannabis Usage Journal is designed to go home with a customer to track their cannabis experience. Employees will provide customer’s a copy of this journal with direction on how to track their experience. This will allow that customer to reflect on the products that they try to determine a product and/or strain preference Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 60 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1.6.6 Delivery Service Procedures Community Veterans of Fresno intends to make full use of its cannabis retail license and create the most attractive business model that fits the needs of all potential customers. Therefore, Community Veterans of Fresno will offer patrons the opportunity to have cannabis or cannabis products delivered. Community Veterans of Fresno will only deliver cannabis in a city or county that does not expressly prohibit it by ordinance. Community Veterans of Fresno will utilize vehicles that are environmentally friendly with a reduced emission rating for delivering cannabis and cannabis products to customers. Community Veterans of Fresno has selected the Tesla Model 3. The Tesla Model 3 is a fully electric vehicle which also achieved a NHTSA 5-star safety rating in every category. Another appealing factor for the Tesla Model 3 vehicle for Community Veterans of Fresno team, beyond its safety rating is that the Model 3 is fully electric eliminating the need to visit a gas station. A single charge provides a range of 322 miles and a 172-mile recharge within 15 minutes. Tesla, a premium, environmentally sustainable company, offers over 16,000 supercharge stations along well traveled routes around the world. As shown in the map below, many of these stations can be found throughout the state of California. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 61 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Delivery Service Procedures Community Veterans of Fresno will limit the hours of operation for delivery activities to the hours of 9:00 a.m. through 9:00 p.m. seven days a week or a reduced duration as stipulated through the discretionary permit. OnFleet – Delivery Dispatch Community Veterans of Fresno will utilize the high-end Onfleet software for driver and delivery dispatch. This will track deliveries to customers real time for full transparency and security. The Onfleet platform is considered the best in the industry for final mile delivery services. The company was founded by a team of engineers from Stanford University and funded by some of Silicon Valley’s top investors. Onfleet provides dispatchers with visibility to all deliveries in transit by tracking the GPS thru the phone of each driver. Using Onfleet and COVA, our transportation capabilities will boast the following features: 1. Ability to create shipping manifests which will contain the following: a. A unique Purchase Order number to track system receipts; b. Name, license number, and premises address for: i. The licensee who possesses the cannabis goods; ii. The licensee transporting the cannabis goods; iii. The licensee receiving the cannabis goods; c. Name and license number of any licensee involved in the activity or transaction who is not shipping, transporting, or receiving the cannabis goods; d. Date and time of activity; e. Date and time of departure from first premises, and estimated time of departure for subsequent premises if cannabis goods are being shipped from multiple premises in one transport vehicle; f. Estimated date and time of arrival at each receiving premises; g. Driver license number for any person driving the transport vehicles; h. Make, model, and license plate number of transport vehicles; and i. Name and type of cannabis goods to be transported. 2. Ability to produce and store package and product tracking numbers. a. All cannabis product sold or transferred between cannabis facilities must have the tracking identification number that is assigned by the statewide monitoring system affixed, tagged, or labeled and recorded, and any other information required by the BCC, the act, and these rules. 3. Ability to digitally track and store information such as: a. Digital signature for delivery; b. Images of products picked-up and delivered; and c. Quantity and product type. 4. Ability to pull reports. a. Real-time inventory reports. b. Real-time location monitoring via GPS. 5. Digital route management. a. Creation of driver routes and sequence product delivery. b. Real-time driver notifications of any changes in a transportation route. c. Store route history. d. Store route notes. e. Log suspicious route activity. Shipping Manifest Community Veterans of Fresno will receive retail customer orders for delivery. These orders will be converted into outgoing shipments and assigned to drivers employed by the company. Pursuant to 16 CCR § 5049, all Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 62 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 shipments of outgoing products will include a detailed shipping manifest. All transportation record keeping will be digitalized and be an output of the inventory tracking system with accurate inventory records. These will be notated as an outbound shipping manifest. Each shipping manifest will contain the following information: 1. Name, CUP number, and originating cannabis business address for: a. The licensee who possesses the cannabis goods; b. The licensee transporting the cannabis goods; and c. The licensee receiving the cannabis goods. 2. Name and address of the individual requesting delivery; 3. Date and time of activity; 4. Date and time of departure from first premises, and estimated time of departure for subsequent premises if cannabis goods are being shipped from multiple premises in one transport vehicle; 5. Estimated date and time of arrival at each receiving premises; 6. Driver license number for any person driving the transport vehicle; 7. Make, model, and license plate number of transport vehicle; 8. Name and type of cannabis goods to be transported; and The shipping manifest will be completed and transmitted into the track and trace system viewable by the BCC. A physical copy of the shipping manifest will be carried in the transport vehicle at all times while transporting cannabis goods. The shipping manifest will be provided to law enforcement and Department of Consumer Affairs agents upon request. Receipt of Inbound Shipments Pursuant to 16 CCR § 5049(b)(6)(A), Community Veterans of Fresno will require that all incoming retail products have a detailed shipping manifest ready on arrival. All inbound shipments will have a detailed shipping manifest that can be used for receipt into the company’s inventory tracking system, COVA. It is expected that the licensed Transport Agent will carry a detail transportation manifest containing: 1. A unique Purchase Order number to track system receipts; 2. Name, license number, and premises address for: a. The licensee who possesses the cannabis goods; b. The licensee transporting the cannabis goods; and c. The licensee receiving the cannabis goods; 3. Name and license number of any licensee involved in the activity or transaction who is not shipping, transporting, or receiving the cannabis goods; 4. Date and time of activity; 5. Date and time of departure from first premises, and estimated time of departure for subsequent premises if cannabis goods are being shipped from multiple premises in one transport vehicle; 6. Estimated date and time of arrival at each receiving premises; 7. Driver license number for any person driving the transport vehicle; 8. Make, model, and license plate number of transport vehicle; and 9. Name and type of cannabis goods to be transported. Upon receipt of cannabis goods for transport, storage, or inventory, the company employee shall ensure that the cannabis goods received are as described in the shipping manifest and shall record acceptance and acknowledgment of the cannabis goods in the track and trace system. If there are any discrepancies between the type or quantity specified in the shipping manifest, whether by type or quantity received by the licensee, the licensee shall record, and document the discrepancy in the track and trace system and in any relevant business record. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 63 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 The shipping manifest will be completed by the distributor and transmitted in the track and trace system to the Bureau and receiving licensee. Delivery Rules Community Veterans of Fresno will adhere to the following rules regarding the vehicle used for delivery as aligned with both local and state laws regarding cannabis operations: • Delivery employees who are carrying cannabis goods for delivery, will only travel in an enclosed motor vehicle where goods are locked in the trunk of the vehicle. • While carrying cannabis goods for delivery, delivery employees shall ensure the cannabis goods are not visible to the public. • In compliance with FMC 9-3310(a)(7), all of Community Veterans of Fresno’s delivery vehicles will be unmarked with no indication that the vehicle is transporting cannabis or cannabis products. • Delivery employees will not leave cannabis goods in an unattended motor vehicle unless the motor vehicle is locked and equipped with an active vehicle alarm system. • Pursuant to 16 CCR § 5417(d), a vehicle used for the delivery of cannabis goods shall be outfitted with a dedicated GPS device. A dedicated GPS device must be owned by the licensee and used for delivery only. • The device shall be either permanently or temporarily affixed to the delivery vehicle and shall remain active and inside of the delivery vehicle at all times during delivery. • Using Onfleet technology, Community Veterans of Fresno will be able to identify the geographic location of all delivery vehicles that are making deliveries for the retailer and shall provide that information to the BCC upon request. • Prior to commencing delivery operations, and prior to the use of any new car in delivery operations, Community Veterans of Fresno will provide the City and State regulating agencies with the following information for all vehicles that will be used to deliver cannabis or cannabis products: proof of ownership or a valid lease; the year, make model, color, license plate number, and Vehicle Identification Number and proof of insurance. The permittee shall notify the City in writing of any changes to this information within 30 calendar days of a change. • Any motor vehicle used by a retailer to deliver cannabis goods is subject to inspection by the BCC. Vehicles used to deliver cannabis goods may be stopped and inspected by the BCC at any licensed premises or during delivery. • Pursuant to 16 CCR § 5418(a), while making deliveries, delivery employees will not carry cannabis goods valued in excess of $5,000 at any time. This value will be determined using the current retail price of all cannabis goods carried by the delivery employees. • Employees shall not consume cannabis goods while delivering cannabis goods to customers. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 64 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Delivery to a Physical Address Pursuant to 16 CCR § 5416, Community Veterans of Fresno will only deliver cannabis goods to a physical address in California. Delivery to parks, schools or any other public facilities will be prohibited. 1. Employees will not leave the State of California while possessing cannabis goods. 2. Community Veterans of Fresno will not deliver cannabis goods to an address located on publicly owned land or any address on land or in a building leased by a public agency. This prohibition applies to land held in trust by the United States for a tribe or an individual tribal member unless the delivery is authorized by and consistent with applicable tribal law. 3. Delivery personnel will follow the same protocol and policies of the retail facility in the verification of the recipient’s age and necessary documentation for the receipt of cannabis or cannabis products. a. All delivery personnel will verify the age and all necessary documentation of each individual to ensure customers are not under the age of twenty-one (21) years. Acceptable forms of documentation will be: i. A document issued by a federal, state, county, or municipal government, or a political subdivision or agency thereof, including, but not limited to, a valid motor vehicle operator's license, that contains the name, date of birth, physical description, and a photo of the person; ii. A valid identification card issued to a member of the Armed Forces that includes a date of birth and a photo of the person; or iii. A valid passport issued by the United States or by a foreign government. b. Those unable to produce acceptable forms of identification verifying they are of age top purchase will not be provided with cannabis products. Delivery Payment Handling Whenever possible, Community Veterans of Fresno will accept credit card payments through the company’s website for cannabis deliveries. Credit card processing in the current landscape is always evolving and not always readily available. When Community Veterans of Fresno is required to accept cash from customers, the cash will be stored in small quantities inside the vehicle. Community Veterans of Fresno will outfit all delivery vehicles with a secured storage container affixed in the passenger side of the vehicle on the floorboard, out of the public view. The storage container will contain a cash box inside the container affixed to the floorboard. Upon receiving cash payments from a customer, the driver will use a digital code to open the storage container. Cash will be put inside of the cash box then the storage container will be returned to the locked position. Upon arriving back to the retail facility, the driver will notify on-site security will be notified. The guard will watch the vehicle for suspicious activity. At that point in time, the storage container will be opened by the driver. The driver will remove the cash box from the storage container and carry it inside. Once it is inside the facility, it will go to the manager’s office for reconciliation. After the cash has been counted, it will be moved to the vault for storage. Section: Business Plan Subsection: Daily Operations Applicant: Community Veterans of Fresno Page 65 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Number of Vehicles At the onset of operations, Community Veterans of Fresno is budgeting for the purchase of 1 Tesla Model 3 vehicle to support its operation. As operations scale, additional vehicles will be purchased. As part of the company’s due diligence, Community Veterans of Fresno is including the purchase of these vehicles in the start-up expenses identified in the Financial section of this plan. Vehicle Records Community Veterans of Fresno will maintain a database of all operational vehicles being used for the delivery of cannabis products. Within this database, Community Veterans of Fresno will create a file for each vehicle. This file will contain the following: 1. Copy of the Vehicle Inspection Report – signed and dated by the inspector; 2. Copy of the Vehicle Registration; 3. Photo image of the license plate; 4. Photo image of the vehicle; 5. Vehicle Make, Model, Year; 6. Copy of the Certificate of Insurance; and 7. Vehicle Maintenance Log Vehicle Inspection Policy In order to ensure that all vehicles remain in working order, Community Veterans of Fresno has created a Vehicle Inspection Checklist. All vehicles will be inspected when they are placed in service then the vehicle will undergo monthly inspections. The vehicle will be inspected by the Operations Manager or designee. Inspection reports will be scanned and saved into the vehicle’s corresponding cloud file. Community Veterans of Fresno will use a professional mechanic for an Annual Certified Safety Inspection for each vehicle. Preventative Maintenance Community Veterans of Fresno will maintain a log for each vehicle that records preventative maintenance for each vehicle. This will include tracking of vehicle mileage and the following items. • Oil Change / Filter / Lube; • Standard PM Inspection; • Tire Rotation; • Diagnostic & Tune-Up; • Service Brakes; • Replace Belts; • Tire Replacement; • Battery Replacement; and • Annual Certified Safety Inspection. Section 2: Social Policy and Local Enterprise Plan Applicant: Community Veterans of Fresno Page 66 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2 SOCIAL POLICY AND LOCAL ENTERPRISE PLAN Given the collective professional and military experiences of the Community Veterans of Fresno’s team, they know that the greatest success is from uplifting those around you. It is their commitment to the City of Fresno to give opportunity to the less fortunate, to lift up their team members, and to offer living wages, with benefits, to their employees. Section: Social Policy and Local Enterprise Plan Subsection: Commitment to Living Wages Applicant: Community Veterans of Fresno Page 67 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.1 COMMITMENT TO LIVING WAGES Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 68 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.1.1 MIT Living Wage Table 2.1.2 Anticipated Employee Pay Rates 2.2 EMPLOYEE BENEFITS 2.2.1 Health Care All full-time employees will be offered health care coverage. Health care coverage will be provided through Kaiser Permanente. KP has been providing affordable health-care options to employees and employers since 1945. Community Veterans of Fresno is pleased to offer our employees competitive wages and comprehensive health care benefits. 5 https://livingwage.mit.edu/counties/06019 Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 69 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Plan Options Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 70 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Sample Plan Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 71 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.2.2 Retirement Plan Community Veterans of Fresno will offer Employees 401K benefits to encourage employees to invest in their future. It is the belief of Community Veterans of Fresno that by offering 401K benefits, it will allow Community Veterans of Fresno to recruit top talent and retain employees. It is the experience of Community Veterans of Fresno, through offering a retirement plan, employees feel the employment is long term and creates a foundation for employees to grow and expand with the company. Employee 401K benefits will be provided by Vanguard. Community Veterans of Fresno will offer employees a 3% matching contribution for individuals who choose to participate in the employee sponsored 401K program. 2.2.3 Vacation Eligible employees (Full Time) in this organization are provided company benefits. Several of the programs such as Social Security, workers' compensation, state disability, and unemployment insurance, cover all employees in the manner prescribed by law. Community Veterans of Fresno will also offer paid time off as detailed below. Holidays Time Off Eligible employees are entitled to the following holidays, as observed by the Company: • New Year’s Day • Memorial Day • Independence Day • Labor Day • Thanksgiving Day • Christmas Day Paid Time Off (PTO) Full-time employees who regularly work 40 or more hours per week on a continuing basis earn paid vacation time after each annual service anniversary with the Company. Part-time and On-Call employees are not eligible for paid vacation time. Employees will be eligible for PTO only after 180 day of employment. • It is the Company’s position that employees need time off to rest, so pay in lieu of vacation time in not permitted. • Vacation time must be taken each year, or the vacation time will be forfeited. Vacation time cannot be accumulated from year to year. • Vacation requests should be in writing and approved in advance by the manager based upon business conditions. A request for time off, paid, or unpaid is not authorized until signed and approved by management. • Upon separation from the Company, associates will be paid any earned and unused vacation time. • PTO can be used for Personal/Sick days after an absence as long as the employee has followed the proper call-off procedure (call and speak to supervisor at least two hours in advance). It is the responsibility of the employee to complete the appropriate paperwork and to obtain approval after their absence to ensure payment of this benefit. • Other than unplanned sick days, PTO requests should be in writing and approved in advance by the manager based upon business conditions. A request for time off, paid, or unpaid is not authorized until signed and approved by management. Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 72 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Length of Service Vacation Available 1 – 4-year anniversary 5 days 5 – 9-year anniversary 10 days 10+ year anniversary 15 days Time Off to Vote Community Veterans of Fresno encourages employees to fulfill their civic responsibilities by voting. If an employee is unable to vote in a statewide election during his or her non-working hours, the employer will grant up to two hours to vote. Employees should request time off to vote from their supervisor at least two working days prior to election day so that the necessary time off can be scheduled at the beginning or end of the work shift, whichever provides the least disruption to the normal work schedule. Jury Duty Community Veterans of Fresno encourages employees to fulfill their civic responsibilities by serving jury duty when required. • Employees must show the jury duty summons to their supervisor as soon as possible so that the supervisor may make arrangements to accommodate the employee's absence. Of course, the employee is expected to report for work if not required to be present in court. • Either the employer or the employee may request an excuse from jury duty if, in the employer's judgment, the employee's absence would create serious operational difficulties. • Accrual for benefits calculation of vacation will not be affected during unpaid jury duty leave. 2.2.4 Medical Leave Paid Medical Leave In accordance with Lab. Code § 246, Community Veterans of Fresno employees will be entitled to receive paid sick days up to 24 hours or three days in each calendar year of employment. This entitlement will begin on the employees 90th day of work and will renew at the start of each calendar year for the duration of employment with Community Veterans of Fresno. Compensation for sick days will be calculated in the same manner as standard wages. Unpaid Medical Leave In accordance with the federal Family and Medical Leave Act (FMLA) and the California Family Rights Act, Community Veterans of Fresno will have policies in place that will protect employees in the event they require time off work to effectively recover from an illness or care for a loved one who is ill or disabled. Community Veterans of Fresno will receive up to 60 working days or 12 workweeks per 12-month period of unpaid leave for a qualified reason. Requirements and Eligibility Employees are eligible for FMLA if they: • Have been with the company for at least a year; or • Have worked at least 1,250 hours during the previous year; and o Are bonding with a new child – whether or not they gave birth or are adopting; o Are recuperating from a serious health condition; o Are caring for a loved one with a serious health condition; o Are dealing with crisis situations stemming from a family member's military service; o Are caring for a loved one who suffered serious injuries during active military service; or o Require prenatal care or are suffering from pregnancy-related illnesses or complications Section: Social Policy and Local Enterprise Plan Subsection: Continuing Education and Employee Training Applicant: Community Veterans of Fresno Page 73 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Requesting Medical Leave For employees to receive benefits, they need to first make Community Veterans of Fresno aware of their situation and their need for leave. Employees are required to give at least a 30-day notice ahead of their leave if possible. If the necessity for leave is not foreseeable, then the notice should be provided "as soon as practicable." Employees will be required to: 1. Submit a doctor's note that clearly establish a medical condition or reason for the employee’s inability to continue work. 2. Provide all available information directly to the Human Resources Department. 2.3 CONTINUING EDUCATION AND EMPLOYEE TRAINING Community Veterans of Fresno is passionate about creating opportunities for employees to advance within the company and look for opportunities to pave the way of success for each employee. Education is certainly a catalyst to future advancement and personal growth; however, Community Veterans of Fresno understands that the cost of education beyond completing high school can often deter people from continuing the educational journey. As Community Veterans of Fresno shares in the goals of the city to support higher education and vocational training for the residents of Fresno, Community Veterans of Fresno hopes to mitigate the financial barriers associated with pursuing education by offering educational reimbursement benefits to encourage self-development. The reimbursement benefit would be extended for certain education-related expenses. This benefit is intended to encourage professionalism and assist employees in increasing effectiveness in their current position, preparing employees for possible advancement, and/or increasing an employee’s adaptability to new ideas and change. 2.3.1 Plan Details The Educational Reimbursement Program will include assistance with the cost of tuition and other expenses related to the pursuit for education related to certifications within the Cannabis industry and any other educational programs as required by the management for the proper functioning of the Dispensary. Benefits may not be substituted for additional wages, as such, employees who choose to not utilize the program forfeit their entitlement to benefits. Employee Eligibility Both Regular Full-time and Regular Part-time employees will be eligible to participate in the program. For eligibility purposes: 1. Regular Full-time means a normal work schedule of at least 40 hours per week, or at least 80 hours on a bi- weekly basis. 2. Regular Part-time means a normal work schedule consisting of at least 20 hours per week, or at least 40 hours on a bi-weekly basis. Community Veterans of Fresno will expect an employee to be employed with them for at least 180 days to ensure the pursuit of further education will not adversely affect job performance. Reimbursement of Fees and Expenses To qualify for reimbursement, an employee will be required to complete the certification or course. No benefit will be payable unless these requirements are met. Once a course has been satisfactorily completed, an employee may request reimbursement for eligible fees and expenses related to the course. Eligible fees and expenses will be reimbursed at 100% up to the annual maximum. Reimbursement Maximum Community Veterans of Fresno will reimburse the employee no more than $5,250 a year for qualified educational programs. Should lawmakers enact an increase or decrease to the $5,250 ceiling, this Plan will automatically adopt Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 74 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 the new ceiling on its effective date. Under Section 127 of the Internal Revenue Code, the employee receives reimbursements under this Plan as tax-free fringe benefits. Reimbursement Deadline Reimbursement requests will need to be submitted no later than six months following completion of the course. A reimbursement request that is submitted more than six months following course completion will not be eligible for reimbursement. Time Off Work Community Veterans of Fresno prefers course schedules be arranged in ways that do not conflict with the employee’s work schedule. However, special situations which might require time off the job will be considered. Such situations might involve the scheduling of an examination by the school or graduation exercises at a time when the employee is usually at work. 2.4 RECRUITMENT PLAN AND SOCIAL POLICY Community Veterans of Fresno is determined to create a facility that brings economic stability to the Fresno community. While there are several facets to the teams plan to make a difference, one branch of that is to bring meaningful employment opportunities to the community. Community Veterans of Fresno will work with a few different Fresno organizations to recruit employees that are both highly qualified and who fall within the parameters that meet the Community Veterans of Fresno’s hiring plan. Examples of partners are discussed below. 2.4.1 Fresno Economic Opportunity Commission Fresno Economic Opportunity Commission offers a Workforce Connection Young Adult Program that assists low-income youth ages 14 through 24 out of school or attending high school services that will keep currently enrolled students engaged in education, the pursuit of high school graduation and becoming a positive contributing member of society. It is the goal of the program to assist students with increasing their academic competencies and preparing them to enter the world of work or higher education while also helping the student to shape their own destiny. The program serves both in school and out of school individuals and attempts to re-engage out of school individuals in high school to facilitate gaining their high school diploma and entering advance training or unsubsidized employment.6 Through this program, Community Veterans of Fresno can effectively and efficiently gain access to young individuals who possess the basic fundamental skills sought to fulfill job duties that can also be part of the company’s apprenticeship programs that will further groom and prepare them for advancement opportunities. 2.4.2 UFCW8 As Community Veterans of Fresno has entered into a labor peace agreement with the UFCW8, this is yet another channel that the team will utilize to recruit employees. The team chose to partner with the UFCW8 as they are experienced in representing both employees and business owners within the cannabis industry. The Union has taken pride in the help it has provided to lead the development and stabilization of the emerging cannabis sector through their innovative Cannabis Workers Rising campaign, which has existed since 2010. The UFCW represents tens of thousands of cannabis workers across multiple states. UFCW members in the legal cannabis industry work in growing and cultivating facilities, manufacturing, and processing facilities, and also in 6 https://fresnoeoc.org/workforce-connection-young-adult-program/ Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 75 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 laboratories and dispensaries. The legal cannabis industry is a newly regulated market that the UFCW recognizes as a source to offer local communities’ jobs with strong wages and benefits that cannot be outsourced. The UFCW offers cannabis workers and business owners, along with patients and coalition allies, the opportunity to work together to accomplish shared goals. By crafting and supporting targeted legislative efforts, along with negotiating the best contracts for workers, they have helped pave the way in setting high standards throughout the industry. The UFCW has been a key leader in coalitions and advocacy groups that work for real change at all levels of policy and have been instrumental in working to advocate for the good jobs provided by the medical cannabis industry 7. Community Veterans of Fresno values the commitment of the UFCW in their efforts in building a successful industry with a thriving, diverse and skilled workforce and through this partnership, the team is excited about the opportunity to bring jobs that pay better wages and provide better benefits that are vital to keeping the economy afloat and bring Fresno families out of poverty. 2.4.3 Workforce Connection Community Veterans of Fresno will also partner with Workforce Connection for recruiting employees. Workforce Connection is funded and directed by the Fresno Regional Workforce Development Board, which works on behalf of employers and job seekers throughout Fresno County to promote and sustain the economic vitality of the region. Workforce Connection works to prepare the people throughout the community for careers in various industries that promote self-sufficiency, not just jobs to carry them through to the next paycheck. They do this by providing opportunities that build the knowledge, skills, and attitudes necessary to meet employer needs and be competitive in the workforce of today. Workforce Connection offers what is referred to as “One-Stop Centers” where adults and dislocated workers have access to education, training, and employment services, as well as referrals (when deemed appropriate) to other services available through their network of partner agencies 8. 7 http://www.ufcw.org/who-we-represent/cannabis/ 8 https://www.workforce-connection.com/adult-services/ Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 76 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.4.4 Social Policy While Community Veterans of Fresno will seek to hire the most qualified persons who apply for employment, Community Veterans of Fresno aims to create meaningful employment opportunities for those who really need it. In compliance with FMC 9-3316(b)(1), Community Veterans of Fresno commits to developing a workforce of a minimum of one-third (1/3) individuals who meet one or more of the following criteria: 1. Annual family income below 80% AMI; which for the Fresno area would be roughly $49,360 per year or less per Fannie Mae Area Median Income Lookup Tool 9. 2. Convicted for a cannabis related crime that could have been prosecuted as a misdemeanor or citation under current State law; 3. Lived in a low to moderate income census tract in the city for a minimum of three (3) years; 4. Veteran; or 5. Former foster home youth who was in foster care as a minor. 6. Unemployed; or 7. Receiving public assistance. Community Veterans of Fresno will maintain full records of each individual hired that meets this criterion and provide the City with ongoing proof of compliance for this requirement. Community Veterans of Fresno’s Public Relations Manager, Desiree Torosian, falls within the parameters of the Social Policy as her current household annual family income falls below the 80% Area Median Income of $49,360. Community Veterans of Fresno is more than thrilled that they can offer her a more meaningful employment opportunity that will provide her both with a career as well as the financial stability that is certain to make a difference for her and her children. Below, the team has provided evidence to support this claim that was graciously provided by Desiree. 9 https://ami-lookup-tool.fanniemae.com/amilookuptool/ Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 77 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Desiree Torosian Evidence of Social Policy Qualified Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 78 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.5 LOCALLY MANAGED ENTERPRISE As previously communicated, the Community Veterans of Fresno team wishes to bring meaningful employment opportunities to the residents of Fresno. Community Veterans of Fresno’s management team is comprised exclusively of Fresno residents. Beyond general management, Community Veterans of Fresno will be looking to recruit employees to fulfill day- to-day operational roles. Recruiting practices will look for professionally qualified individuals that possess a passion for delivering an exceptional customer experience. The Community Veterans of Fresno will look for individuals who reside within the Fresno community providing preference to qualified individuals who are local to the facility. The Community Veterans of Fresno believes that by hiring employees who are local to the facility not only positively boosts the local economy, but also provides the type of environment that the company strives for. Typically, local employees have established relationships with others within the community and it is these types of relationships and friendliness that creates the overall family feel within a retail environment. Community Veterans of Fresno Management Team Name Role Fresno Resident Address Hilary Traina General Manager Yes 7055 E. Garland Fresno, CA 93737 Desiree Torosian Public Relations Manager Yes 4372 S Cherry Ave Fresno, CA 93703 Paul Cornacchia Security Manager Yes 5028 W. Herndon Ave. Fresno, CA 93722 Heather Weatherly Procurement Manager Yes 5122 E Olive Ave #225 Fresno, CA 93727 Kara Castaneda Sales Manager Yes 5436 W. Peralta Way Fresno, CA 93722 2.5.1 Evidence of Residency Each of the above managers has provided evidence of their residency for the city to review. Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 79 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 80 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 81 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 82 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Employees, Title/Position, and Responsibilities Applicant: Community Veterans of Fresno Page 83 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.6 EMPLOYEES, TITLE/POSITION, AND RESPONSIBILITIES Community Veterans of Fresno understands that the organizational structure is important in creating standard practices and operating procedures throughout its facilities. The organizational structure allows Community Veterans of Fresno to clearly define the role and responsibilities for each of its team members and staff to drive accountability and empowerment for each and every staff member. Below is an overview of the intended organizational structure, highlights of each role and its assigned responsibilities. In accordance with FMC 9- 3309(i)(1) and 16 CCR § 5031, Community Veterans of Fresno will not allow an individual less than twenty-one (21) years of age to work within the licensed premises or handle cannabis and/or cannabis products. Upon the start of operations, Community Veterans of Fresno intends to hire 16 people consisting of: 2.6.1 Retail Store Manager The Retail Store Manager will manage Community Veterans of Fresno’s retail store. As such, the Retail Store Manager will have a variety of responsibilities. To illustrate, the Retail Store Manager is responsible for hiring potential employees, collecting, and returning agent identification cards, and ensuring all agents complete all Program Training within 90 days of employment. Additionally, the Retail Store Manager will train all agents on inventory, sales, security, sales, and operation procedures. Each day, the Retail Store Manager will open and close the retail store, conduct beginning of day inventory audit, oversee sales and operations, and conduct end of day inventory audit. In addition, the Retail Store Manager is responsible for maintaining facility records, inspecting and accepting deliveries, disposing of cannabis waste, reconcile inventory discrepancies as needed, review surveillance equipment and footage, and well as maintain contain contact with the Department and the State/Local Police in the event of an emergency. 2.6.2 Shift Leader The Shift Leader will work directly under the Retail Store Manager. The Shift Leader will assist the Retail Store Manager of the management of retail operations by overseeing and facilitating sales, supporting retail sales associates as needed, retrieving cannabis and cannabis products from restricted access areas, and ensuring that the appropriate number of customers have access to the retail area. In addition to overseeing sales, the Shift Leader will create employee retail sales associate work schedules and maintain the interior cleanliness of Community Veterans of Fresno’s retail facility during business hours. 2.6.3 Retail Sales Associate Each Retail Sales Associate will facilitate sales within Community Veterans of Fresno’s store. During each sale, each Retail Sales Associate will engage and develop a relationship with the customer. Each Retail Sales Associate will get to know each customer to make adequate cannabis and cannabis product recommendations. During each sale, each Retail Sales Associate will educate each customer about the product the customer intends to purchase or the product the customer does in fact purchase. Subsequently, the Retail Sales Associate will create an inventory record for each sale conducted in Community Veterans of Fresno’s store. 2.6.4 Inventory Control Specialist The Inventory Control Specialist will review and monitor inventory levels. Each day, the Inventory Control Specialist will conduct beginning of day and end of day inventory data entries. The Inventory Control Specialist will use the data collected each day to monitor inventory levels for each cannabis and cannabis product in the store. The Inventory Control Specialist will purchase inventories of cannabis and cannabis products, with the approval of Section: Social Policy and Local Enterprise Plan Subsection: Employees, Title/Position, and Responsibilities Applicant: Community Veterans of Fresno Page 84 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 the Retail Store Manager, when inventory becomes too low. In addition to monitoring inventory day-to-day, the Inventory Control Specialist will research cannabis and cannabis product trends and will make purchasing adjustments, again, with the approval of the Retail Store Manager, to ensure Community Veterans of Fresno carries the highest demanded products. Furthermore, the Inventory Control Specialist will develop and maintain relationships with cultivation, craft grow, and infuser organizations. 2.6.5 Cannabis Employee Background Check Community Veterans of Fresno will identify each prospective employee and submit for each: the full name, address, telephone number, company title, primary responsibilities; and a valid government-issued form of identification, together with any other related information requested by the Chief of Police for the purpose of conducting mandatory background checks. Community Veterans of Fresno understands that evidence that a prospective employee has been convicted of any the following offenses shall be grounds for denial of employment. 1. A violent or serious felony conviction, as specified in Penal Code Section 667. 5(c) or Section 1192. 7(c). 2. A felony conviction involving fraud, deceit, or embezzlement. 3. A felony conviction for hiring, employing, or using a minor in transporting, carrying, selling, giving away, preparing for sale, or peddling, any controlled substance to a minor; or selling, offering to sell, furnishing, offering to furnish, administering, or giving any controlled substance to a minor. 4. A felony conviction for drug trafficking with enhancements pursuant to Health and Safety Code Section 11370.4 or 11379. 8. 5. Conviction of illegal use, possession, transportation, distribution, or similar activities related to controlled substances, as defined in the Federal Controlled Substances Act, not including cannabis- related offenses for which the conviction occurred after the passage of the Compassionate Use Act of 1996. Further, Community Veterans of Fresno understands that if they wish to hire an individual despite such conviction, a member of the Community Veterans of Fresno team is to appeal to the Chief of Police, who at his or her sole discretion may issue a written waiver. Without such waiver issued by the Chief of Police, any violation to this rule is grounds for immediate suspension of the commercial cannabis business permit. Employee Badge Once an employee has cleared background screening and cleared by the Chief of Police for employment, Community Veterans of Fresno will provide each employee with an Employee Identification Badge pursuant to 16 CCR § 5043. All agents, officers, or other persons acting for Community Veterans of Fresno will display a laminated or plastic-coated identification badge issued by Community Veterans of Fresno at all times while engaging in commercial cannabis activity. The identification badge will, at a minimum, include the Community Veterans of Fresno name and license number, the employee’s first name, an employee number exclusively assigned to that employee for identification purposes, and a color photograph of the employee that clearly shows the full front of the employee’s face and that is at least 1 inch in width and 1.5 inches in height. Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 85 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.7 LABOR PEACE AGREEMENT As mandated by State Law and as a commitment to company employees, the Community Veterans of Fresno team has entered into a Labor Peace Agreement with UFCW 8-Golden State. The agreement between the Community Veterans of Fresno and UFCW emphasizes equal pay and fair treatment in the workplace regardless of gender, race, religion, sexual orientation, disability, or cultural background. Community Veterans of Fresno will work with UFCW because UFCW is a key leader in coalitions and advocacy groups that work for real change at all levels of policy. UFCW has a remarkable diversity track-record and is uniquely positioned to help Community Veterans of Fresno recruit, train, and retain a skilled and diverse workforce. In the agreement with UFCW, Community Veterans of Fresno agrees to the following terms, among others: 1. Community Veterans of Fresno will remain neutral towards UFCW’s organizing effort. In other words, Community Veterans of Fresno will not interfere with UFCW in any manner. 2. Community Veterans of Fresno will allow UFCW to come to Community Veterans of Fresno’s facility to speak with the employees during non-work hours, such as meal and work breaks, in a private, unmonitored room inside the Community Veterans of Fresno facility. 3. Community Veterans of Fresno will recognize UFCW as the exclusive representative of the Community Veterans of Fresno’s employees in a labor dispute. 4. Community Veterans of Fresno waives its right under the National Labor Relations Act to file any petition with the National Labor Relations Board for any election in any bargaining unit. Community Veterans of Fresno agrees that final and binding arbitration will be the exclusive remedy for any alleged violations. Please find attached below the executed agreement between Community Veterans of Fresno and the UFCW 8. Community Veterans of Fresno is PROUD to be a union shop – offering employees union benefits. The City of Fresno can count on this company to uplift our employees! Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 86 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 87 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 88 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Workforce Plan Applicant: Community Veterans of Fresno Page 89 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.8 WORKFORCE PLAN Provide a workforce plan that includes at a minimum the following provisions: 2.8.1 Commitment of a Minimum 30% Local Hiring Community Veterans of Fresno will strive to hire a minimum of 50% of employees from the City of Fresno and will strive to give preference to qualified individuals who demonstrate a prior cannabis related arrest, are low income or both. A focus on local employees provides Community Veterans of Fresno a great opportunity to network within the city at large and build strong relationships with the community. The interview process will include the vetting of potential employees. This vetting will be rigorous and will follow industry standards to ensure that only the most qualified and morally upstanding candidates are selected for employment. All potential employees will first obtain a commercial cannabis employee work permit from the City prior to performing any work. Community Veterans of Fresno will cover all costs associated with this regulatory requirement. The company is committed to hiring all (or substantially all) of its employees from local Fresno residents. One of the greatest advantages of business in the economy of a city is to raise the employment level locally. In addition, other members of the business community will benefit from the design, construction and other vendor relationships required by the business. On 10/19, Community Veterans of Fresno posted a job on Indeed to find a store manager. As of 11/17 - there were 151 Active Candidates. CEO, Daniel Wise personally reviews each applicant and is providing preference to experienced Fresno residents. After reviewing the most qualified resumes, he conducts a brief interview to determine if the employee meets the high standards to become a Community Veterans of Fresno employee. 2.8.2 Commitment to Offering Apprenticeships Community Veterans of Fresno, in additional to an educational reimbursement program (see employee benefits section) will offer an extensive, continuous training program for all employees and positions, to further cannabis industry education. This cannabis focused educational program will provide employees the opportunity to not only improve their knowledge and skillset within current roles within the company, but also provide advance knowledge and skillsets required to advance within the company. Community Veterans of Fresno will encourage all team members to seek out additional opportunities to take courses, attend seminars, take online web series or classes, and more, to deepen their knowledge and skills in the cannabis industry. Community Veterans of Fresno will fully fund these educational opportunities upon enrollment, only requiring the employee to provide evidence of completion to add to their personnel file. Some educational opportunities employees may partake in include:  Oaksterdam University  THC University Online Training Courses  Cannabis Training University  Various cannabis events across Southern California Section: Social Policy and Local Enterprise Plan Subsection: Social Equity Incubator Plan Applicant: Community Veterans of Fresno Page 90 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.8.3 Commitment to Paying Living Wages Community Veterans of Fresno’s objective is to retain loyal employees who will provide a lot of value to Community Veterans of Fresno customers. To ensure Community Veterans of Fresno retains the most talented employees, Community Veterans of Fresno will pay each member of its team competitively. Looking towards the living wage for Fresno County minimum wage, Community Veterans of Fresno agents will be paid much higher than is required for living. Community Veterans of Fresno agents who have households with 1 adult and 0 children will make a premium of 105-241% of the Fresno County recommended living wage, and a premium of 150-233% of California’s minimum wage as illustrated below. Included with compensation, the team has additionally accounted for the associated employee benefits and the additional cost of employee background screening. Employee Salary Projections 2.9 SOCIAL EQUITY INCUBATOR PLAN Community Veterans of Fresno is committed to providing various forms of support to local cannabis social equity businesses in an effort to build a successful and compliant cannabis industry that brings to the community high quality cannabis and cannabis products. 2.9.1 Mentorship and Training Program As exemplified throughout the various sections of this application, this team holds unparalleled knowledge and experience within the cannabis industry as well as business development/management. The Community Veterans of Fresno team also share a passion around the building of a successful cannabis industry and is willing to provide several forms of mentorship, training, technical and financial assistance to local cannabis social equity businesses. 1 2 3 4 5 6 7 8 9 10 Employee Background Screeening $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 Payroll Taxes and Benefits- Indirect $92,736 $151,296 $166,426 $174,747 $183,484 $192,658 $202,291 $212,406 $223,026 $234,178 Salary $463,680 $756,480 $832,128 $873,734 $917,421 $963,292 $1,011,457 $1,062,030 $1,115,131 $1,170,888 $- $200,000 $400,000 $600,000 $800,000 $1,000,000 $1,200,000 $1,400,000 $1,600,000 10 Year Salary Projections Section: Social Policy and Local Enterprise Plan Subsection: Social Equity Incubator Plan Applicant: Community Veterans of Fresno Page 91 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 The Community Veterans of Fresno team will create an online portal welcoming local cannabis social equity business to reach out to the ownership team to directly discuss their specific needs. The team will analyze their request and put together a specific support plan tailored for the company considering their projected goals, skills, resources, and needs. The Community Veterans of Fresno team can provide an array of services from helping develop business plans and standardized operations, to creating connections with professional vendors that can help with various elements of commercial cannabis business operations. The teams expansive experience in business ownership within the cannabis industry creates opportunities for all business types to participate in the teams Social Equity Incubator Program, not limited to retail settings only. 2.9.2 Dedicated Shelf Space to Promote Local Fresno Cultivators and Manufacturers The Community Veterans of Fresno team believes that now, more than ever, communities must stick together. Small businesses should make an active effort to support other small businesses. Daniel and Kendall believe that this is a good business practice and intends to reach out to businesses in the Fresno community to source as many products and services as possible. The Community Veterans of Fresno team values the communities understanding that without community members, strong leadership and structure, and good business practices, economies would fall and no business, big or small, would achieve the full potential of success. While the Community Veterans of Fresno team prides itself on providing the community with high quality products, the Community Veterans of Fresno team also prides itself contributing to the good and prosperity within the communities it serves. For that reason, though the team will look to source the highest quality and purest products available in the market, the team will also make every possible attempt to source products from local cultivators and manufacturers within the Fresno area. Depending on availability, the company is committed to sourcing a minimum of 50% of our products from this area. In our purchasing system, local vendors will be given a flag to demonstrate they are a preferred vendor. The Community Veterans of Fresno team will utilize the California Cannabis Portal to stay up to date on all licensed cultivators and manufacturers in the Fresno area. Section 2: Social Policy and Local Enterprise Plan Applicant: Community Veterans of Fresno Page 66 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2 SOCIAL POLICY AND LOCAL ENTERPRISE PLAN Given the collective professional and military experiences of the Community Veterans of Fresno’s team, they know that the greatest success is from uplifting those around you. It is their commitment to the City of Fresno to give opportunity to the less fortunate, to lift up their team members, and to offer living wages, with benefits, to their employees. Section: Social Policy and Local Enterprise Plan Subsection: Commitment to Living Wages Applicant: Community Veterans of Fresno Page 67 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.1 COMMITMENT TO LIVING WAGES Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 68 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.1.1 MIT Living Wage Table 2.1.2 Anticipated Employee Pay Rates 2.2 EMPLOYEE BENEFITS 2.2.1 Health Care All full-time employees will be offered health care coverage. Health care coverage will be provided through Kaiser Permanente. KP has been providing affordable health-care options to employees and employers since 1945. Community Veterans of Fresno is pleased to offer our employees competitive wages and comprehensive health care benefits. 5 https://livingwage.mit.edu/counties/06019 Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 69 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Plan Options Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 70 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Sample Plan Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 71 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.2.2 Retirement Plan Community Veterans of Fresno will offer Employees 401K benefits to encourage employees to invest in their future. It is the belief of Community Veterans of Fresno that by offering 401K benefits, it will allow Community Veterans of Fresno to recruit top talent and retain employees. It is the experience of Community Veterans of Fresno, through offering a retirement plan, employees feel the employment is long term and creates a foundation for employees to grow and expand with the company. Employee 401K benefits will be provided by Vanguard. Community Veterans of Fresno will offer employees a 3% matching contribution for individuals who choose to participate in the employee sponsored 401K program. 2.2.3 Vacation Eligible employees (Full Time) in this organization are provided company benefits. Several of the programs such as Social Security, workers' compensation, state disability, and unemployment insurance, cover all employees in the manner prescribed by law. Community Veterans of Fresno will also offer paid time off as detailed below. Holidays Time Off Eligible employees are entitled to the following holidays, as observed by the Company: • New Year’s Day • Memorial Day • Independence Day • Labor Day • Thanksgiving Day • Christmas Day Paid Time Off (PTO) Full-time employees who regularly work 40 or more hours per week on a continuing basis earn paid vacation time after each annual service anniversary with the Company. Part-time and On-Call employees are not eligible for paid vacation time. Employees will be eligible for PTO only after 180 day of employment. • It is the Company’s position that employees need time off to rest, so pay in lieu of vacation time in not permitted. • Vacation time must be taken each year, or the vacation time will be forfeited. Vacation time cannot be accumulated from year to year. • Vacation requests should be in writing and approved in advance by the manager based upon business conditions. A request for time off, paid, or unpaid is not authorized until signed and approved by management. • Upon separation from the Company, associates will be paid any earned and unused vacation time. • PTO can be used for Personal/Sick days after an absence as long as the employee has followed the proper call-off procedure (call and speak to supervisor at least two hours in advance). It is the responsibility of the employee to complete the appropriate paperwork and to obtain approval after their absence to ensure payment of this benefit. • Other than unplanned sick days, PTO requests should be in writing and approved in advance by the manager based upon business conditions. A request for time off, paid, or unpaid is not authorized until signed and approved by management. Section: Social Policy and Local Enterprise Plan Subsection: Employee Benefits Applicant: Community Veterans of Fresno Page 72 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Length of Service Vacation Available 1 – 4-year anniversary 5 days 5 – 9-year anniversary 10 days 10+ year anniversary 15 days Time Off to Vote Community Veterans of Fresno encourages employees to fulfill their civic responsibilities by voting. If an employee is unable to vote in a statewide election during his or her non-working hours, the employer will grant up to two hours to vote. Employees should request time off to vote from their supervisor at least two working days prior to election day so that the necessary time off can be scheduled at the beginning or end of the work shift, whichever provides the least disruption to the normal work schedule. Jury Duty Community Veterans of Fresno encourages employees to fulfill their civic responsibilities by serving jury duty when required. • Employees must show the jury duty summons to their supervisor as soon as possible so that the supervisor may make arrangements to accommodate the employee's absence. Of course, the employee is expected to report for work if not required to be present in court. • Either the employer or the employee may request an excuse from jury duty if, in the employer's judgment, the employee's absence would create serious operational difficulties. • Accrual for benefits calculation of vacation will not be affected during unpaid jury duty leave. 2.2.4 Medical Leave Paid Medical Leave In accordance with Lab. Code § 246, Community Veterans of Fresno employees will be entitled to receive paid sick days up to 24 hours or three days in each calendar year of employment. This entitlement will begin on the employees 90th day of work and will renew at the start of each calendar year for the duration of employment with Community Veterans of Fresno. Compensation for sick days will be calculated in the same manner as standard wages. Unpaid Medical Leave In accordance with the federal Family and Medical Leave Act (FMLA) and the California Family Rights Act, Community Veterans of Fresno will have policies in place that will protect employees in the event they require time off work to effectively recover from an illness or care for a loved one who is ill or disabled. Community Veterans of Fresno will receive up to 60 working days or 12 workweeks per 12-month period of unpaid leave for a qualified reason. Requirements and Eligibility Employees are eligible for FMLA if they: • Have been with the company for at least a year; or • Have worked at least 1,250 hours during the previous year; and o Are bonding with a new child – whether or not they gave birth or are adopting; o Are recuperating from a serious health condition; o Are caring for a loved one with a serious health condition; o Are dealing with crisis situations stemming from a family member's military service; o Are caring for a loved one who suffered serious injuries during active military service; or o Require prenatal care or are suffering from pregnancy-related illnesses or complications Section: Social Policy and Local Enterprise Plan Subsection: Continuing Education and Employee Training Applicant: Community Veterans of Fresno Page 73 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Requesting Medical Leave For employees to receive benefits, they need to first make Community Veterans of Fresno aware of their situation and their need for leave. Employees are required to give at least a 30-day notice ahead of their leave if possible. If the necessity for leave is not foreseeable, then the notice should be provided "as soon as practicable." Employees will be required to: 1. Submit a doctor's note that clearly establish a medical condition or reason for the employee’s inability to continue work. 2. Provide all available information directly to the Human Resources Department. 2.3 CONTINUING EDUCATION AND EMPLOYEE TRAINING Community Veterans of Fresno is passionate about creating opportunities for employees to advance within the company and look for opportunities to pave the way of success for each employee. Education is certainly a catalyst to future advancement and personal growth; however, Community Veterans of Fresno understands that the cost of education beyond completing high school can often deter people from continuing the educational journey. As Community Veterans of Fresno shares in the goals of the city to support higher education and vocational training for the residents of Fresno, Community Veterans of Fresno hopes to mitigate the financial barriers associated with pursuing education by offering educational reimbursement benefits to encourage self-development. The reimbursement benefit would be extended for certain education-related expenses. This benefit is intended to encourage professionalism and assist employees in increasing effectiveness in their current position, preparing employees for possible advancement, and/or increasing an employee’s adaptability to new ideas and change. 2.3.1 Plan Details The Educational Reimbursement Program will include assistance with the cost of tuition and other expenses related to the pursuit for education related to certifications within the Cannabis industry and any other educational programs as required by the management for the proper functioning of the Dispensary. Benefits may not be substituted for additional wages, as such, employees who choose to not utilize the program forfeit their entitlement to benefits. Employee Eligibility Both Regular Full-time and Regular Part-time employees will be eligible to participate in the program. For eligibility purposes: 1. Regular Full-time means a normal work schedule of at least 40 hours per week, or at least 80 hours on a bi- weekly basis. 2. Regular Part-time means a normal work schedule consisting of at least 20 hours per week, or at least 40 hours on a bi-weekly basis. Community Veterans of Fresno will expect an employee to be employed with them for at least 180 days to ensure the pursuit of further education will not adversely affect job performance. Reimbursement of Fees and Expenses To qualify for reimbursement, an employee will be required to complete the certification or course. No benefit will be payable unless these requirements are met. Once a course has been satisfactorily completed, an employee may request reimbursement for eligible fees and expenses related to the course. Eligible fees and expenses will be reimbursed at 100% up to the annual maximum. Reimbursement Maximum Community Veterans of Fresno will reimburse the employee no more than $5,250 a year for qualified educational programs. Should lawmakers enact an increase or decrease to the $5,250 ceiling, this Plan will automatically adopt Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 74 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 the new ceiling on its effective date. Under Section 127 of the Internal Revenue Code, the employee receives reimbursements under this Plan as tax-free fringe benefits. Reimbursement Deadline Reimbursement requests will need to be submitted no later than six months following completion of the course. A reimbursement request that is submitted more than six months following course completion will not be eligible for reimbursement. Time Off Work Community Veterans of Fresno prefers course schedules be arranged in ways that do not conflict with the employee’s work schedule. However, special situations which might require time off the job will be considered. Such situations might involve the scheduling of an examination by the school or graduation exercises at a time when the employee is usually at work. 2.4 RECRUITMENT PLAN AND SOCIAL POLICY Community Veterans of Fresno is determined to create a facility that brings economic stability to the Fresno community. While there are several facets to the teams plan to make a difference, one branch of that is to bring meaningful employment opportunities to the community. Community Veterans of Fresno will work with a few different Fresno organizations to recruit employees that are both highly qualified and who fall within the parameters that meet the Community Veterans of Fresno’s hiring plan. Examples of partners are discussed below. 2.4.1 Fresno Economic Opportunity Commission Fresno Economic Opportunity Commission offers a Workforce Connection Young Adult Program that assists low-income youth ages 14 through 24 out of school or attending high school services that will keep currently enrolled students engaged in education, the pursuit of high school graduation and becoming a positive contributing member of society. It is the goal of the program to assist students with increasing their academic competencies and preparing them to enter the world of work or higher education while also helping the student to shape their own destiny. The program serves both in school and out of school individuals and attempts to re-engage out of school individuals in high school to facilitate gaining their high school diploma and entering advance training or unsubsidized employment.6 Through this program, Community Veterans of Fresno can effectively and efficiently gain access to young individuals who possess the basic fundamental skills sought to fulfill job duties that can also be part of the company’s apprenticeship programs that will further groom and prepare them for advancement opportunities. 2.4.2 UFCW8 As Community Veterans of Fresno has entered into a labor peace agreement with the UFCW8, this is yet another channel that the team will utilize to recruit employees. The team chose to partner with the UFCW8 as they are experienced in representing both employees and business owners within the cannabis industry. The Union has taken pride in the help it has provided to lead the development and stabilization of the emerging cannabis sector through their innovative Cannabis Workers Rising campaign, which has existed since 2010. The UFCW represents tens of thousands of cannabis workers across multiple states. UFCW members in the legal cannabis industry work in growing and cultivating facilities, manufacturing, and processing facilities, and also in 6 https://fresnoeoc.org/workforce-connection-young-adult-program/ Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 75 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 laboratories and dispensaries. The legal cannabis industry is a newly regulated market that the UFCW recognizes as a source to offer local communities’ jobs with strong wages and benefits that cannot be outsourced. The UFCW offers cannabis workers and business owners, along with patients and coalition allies, the opportunity to work together to accomplish shared goals. By crafting and supporting targeted legislative efforts, along with negotiating the best contracts for workers, they have helped pave the way in setting high standards throughout the industry. The UFCW has been a key leader in coalitions and advocacy groups that work for real change at all levels of policy and have been instrumental in working to advocate for the good jobs provided by the medical cannabis industry 7. Community Veterans of Fresno values the commitment of the UFCW in their efforts in building a successful industry with a thriving, diverse and skilled workforce and through this partnership, the team is excited about the opportunity to bring jobs that pay better wages and provide better benefits that are vital to keeping the economy afloat and bring Fresno families out of poverty. 2.4.3 Workforce Connection Community Veterans of Fresno will also partner with Workforce Connection for recruiting employees. Workforce Connection is funded and directed by the Fresno Regional Workforce Development Board, which works on behalf of employers and job seekers throughout Fresno County to promote and sustain the economic vitality of the region. Workforce Connection works to prepare the people throughout the community for careers in various industries that promote self-sufficiency, not just jobs to carry them through to the next paycheck. They do this by providing opportunities that build the knowledge, skills, and attitudes necessary to meet employer needs and be competitive in the workforce of today. Workforce Connection offers what is referred to as “One-Stop Centers” where adults and dislocated workers have access to education, training, and employment services, as well as referrals (when deemed appropriate) to other services available through their network of partner agencies 8. 7 http://www.ufcw.org/who-we-represent/cannabis/ 8 https://www.workforce-connection.com/adult-services/ Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 76 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.4.4 Social Policy While Community Veterans of Fresno will seek to hire the most qualified persons who apply for employment, Community Veterans of Fresno aims to create meaningful employment opportunities for those who really need it. In compliance with FMC 9-3316(b)(1), Community Veterans of Fresno commits to developing a workforce of a minimum of one-third (1/3) individuals who meet one or more of the following criteria: 1. Annual family income below 80% AMI; which for the Fresno area would be roughly $49,360 per year or less per Fannie Mae Area Median Income Lookup Tool 9. 2. Convicted for a cannabis related crime that could have been prosecuted as a misdemeanor or citation under current State law; 3. Lived in a low to moderate income census tract in the city for a minimum of three (3) years; 4. Veteran; or 5. Former foster home youth who was in foster care as a minor. 6. Unemployed; or 7. Receiving public assistance. Community Veterans of Fresno will maintain full records of each individual hired that meets this criterion and provide the City with ongoing proof of compliance for this requirement. Community Veterans of Fresno’s Public Relations Manager, Desiree Torosian, falls within the parameters of the Social Policy as her current household annual family income falls below the 80% Area Median Income of $49,360. Community Veterans of Fresno is more than thrilled that they can offer her a more meaningful employment opportunity that will provide her both with a career as well as the financial stability that is certain to make a difference for her and her children. Below, the team has provided evidence to support this claim that was graciously provided by Desiree. 9 https://ami-lookup-tool.fanniemae.com/amilookuptool/ Section: Social Policy and Local Enterprise Plan Subsection: Recruitment Plan and Social Policy Applicant: Community Veterans of Fresno Page 77 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 78 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.5 LOCALLY MANAGED ENTERPRISE As previously communicated, the Community Veterans of Fresno team wishes to bring meaningful employment opportunities to the residents of Fresno. Community Veterans of Fresno’s management team is comprised exclusively of Fresno residents. Beyond general management, Community Veterans of Fresno will be looking to recruit employees to fulfill day- to-day operational roles. Recruiting practices will look for professionally qualified individuals that possess a passion for delivering an exceptional customer experience. The Community Veterans of Fresno will look for individuals who reside within the Fresno community providing preference to qualified individuals who are local to the facility. The Community Veterans of Fresno believes that by hiring employees who are local to the facility not only positively boosts the local economy, but also provides the type of environment that the company strives for. Typically, local employees have established relationships with others within the community and it is these types of relationships and friendliness that creates the overall family feel within a retail environment. Community Veterans of Fresno Management Team Name Role Fresno Resident Address Hilary Traina General Manager Yes Desiree Torosian Public Relations Manager Yes Paul Cornacchia Security Manager Yes Heather Weatherly Procurement Manager Yes Kara Castaneda Sales Manager Yes 2.5.1 Evidence of Residency Each of the above managers has provided evidence of their residency for the city to review. Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 79 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 80 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 81 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Locally Managed Enterprise Applicant: Community Veterans of Fresno Page 82 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Employees, Title/Position, and Responsibilities Applicant: Community Veterans of Fresno Page 83 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.6 EMPLOYEES, TITLE/POSITION, AND RESPONSIBILITIES Community Veterans of Fresno understands that the organizational structure is important in creating standard practices and operating procedures throughout its facilities. The organizational structure allows Community Veterans of Fresno to clearly define the role and responsibilities for each of its team members and staff to drive accountability and empowerment for each and every staff member. Below is an overview of the intended organizational structure, highlights of each role and its assigned responsibilities. In accordance with FMC 9- 3309(i)(1) and 16 CCR § 5031, Community Veterans of Fresno will not allow an individual less than twenty-one (21) years of age to work within the licensed premises or handle cannabis and/or cannabis products. Upon the start of operations, Community Veterans of Fresno intends to hire 16 people consisting of: 2.6.1 Retail Store Manager The Retail Store Manager will manage Community Veterans of Fresno’s retail store. As such, the Retail Store Manager will have a variety of responsibilities. To illustrate, the Retail Store Manager is responsible for hiring potential employees, collecting, and returning agent identification cards, and ensuring all agents complete all Program Training within 90 days of employment. Additionally, the Retail Store Manager will train all agents on inventory, sales, security, sales, and operation procedures. Each day, the Retail Store Manager will open and close the retail store, conduct beginning of day inventory audit, oversee sales and operations, and conduct end of day inventory audit. In addition, the Retail Store Manager is responsible for maintaining facility records, inspecting and accepting deliveries, disposing of cannabis waste, reconcile inventory discrepancies as needed, review surveillance equipment and footage, and well as maintain contain contact with the Department and the State/Local Police in the event of an emergency. 2.6.2 Shift Leader The Shift Leader will work directly under the Retail Store Manager. The Shift Leader will assist the Retail Store Manager of the management of retail operations by overseeing and facilitating sales, supporting retail sales associates as needed, retrieving cannabis and cannabis products from restricted access areas, and ensuring that the appropriate number of customers have access to the retail area. In addition to overseeing sales, the Shift Leader will create employee retail sales associate work schedules and maintain the interior cleanliness of Community Veterans of Fresno’s retail facility during business hours. 2.6.3 Retail Sales Associate Each Retail Sales Associate will facilitate sales within Community Veterans of Fresno’s store. During each sale, each Retail Sales Associate will engage and develop a relationship with the customer. Each Retail Sales Associate will get to know each customer to make adequate cannabis and cannabis product recommendations. During each sale, each Retail Sales Associate will educate each customer about the product the customer intends to purchase or the product the customer does in fact purchase. Subsequently, the Retail Sales Associate will create an inventory record for each sale conducted in Community Veterans of Fresno’s store. 2.6.4 Inventory Control Specialist The Inventory Control Specialist will review and monitor inventory levels. Each day, the Inventory Control Specialist will conduct beginning of day and end of day inventory data entries. The Inventory Control Specialist will use the data collected each day to monitor inventory levels for each cannabis and cannabis product in the store. The Inventory Control Specialist will purchase inventories of cannabis and cannabis products, with the approval of Section: Social Policy and Local Enterprise Plan Subsection: Employees, Title/Position, and Responsibilities Applicant: Community Veterans of Fresno Page 84 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 the Retail Store Manager, when inventory becomes too low. In addition to monitoring inventory day-to-day, the Inventory Control Specialist will research cannabis and cannabis product trends and will make purchasing adjustments, again, with the approval of the Retail Store Manager, to ensure Community Veterans of Fresno carries the highest demanded products. Furthermore, the Inventory Control Specialist will develop and maintain relationships with cultivation, craft grow, and infuser organizations. 2.6.5 Cannabis Employee Background Check Community Veterans of Fresno will identify each prospective employee and submit for each: the full name, address, telephone number, company title, primary responsibilities; and a valid government-issued form of identification, together with any other related information requested by the Chief of Police for the purpose of conducting mandatory background checks. Community Veterans of Fresno understands that evidence that a prospective employee has been convicted of any the following offenses shall be grounds for denial of employment. 1. A violent or serious felony conviction, as specified in Penal Code Section 667. 5(c) or Section 1192. 7(c). 2. A felony conviction involving fraud, deceit, or embezzlement. 3. A felony conviction for hiring, employing, or using a minor in transporting, carrying, selling, giving away, preparing for sale, or peddling, any controlled substance to a minor; or selling, offering to sell, furnishing, offering to furnish, administering, or giving any controlled substance to a minor. 4. A felony conviction for drug trafficking with enhancements pursuant to Health and Safety Code Section 11370.4 or 11379. 8. 5. Conviction of illegal use, possession, transportation, distribution, or similar activities related to controlled substances, as defined in the Federal Controlled Substances Act, not including cannabis- related offenses for which the conviction occurred after the passage of the Compassionate Use Act of 1996. Further, Community Veterans of Fresno understands that if they wish to hire an individual despite such conviction, a member of the Community Veterans of Fresno team is to appeal to the Chief of Police, who at his or her sole discretion may issue a written waiver. Without such waiver issued by the Chief of Police, any violation to this rule is grounds for immediate suspension of the commercial cannabis business permit. Employee Badge Once an employee has cleared background screening and cleared by the Chief of Police for employment, Community Veterans of Fresno will provide each employee with an Employee Identification Badge pursuant to 16 CCR § 5043. All agents, officers, or other persons acting for Community Veterans of Fresno will display a laminated or plastic-coated identification badge issued by Community Veterans of Fresno at all times while engaging in commercial cannabis activity. The identification badge will, at a minimum, include the Community Veterans of Fresno name and license number, the employee’s first name, an employee number exclusively assigned to that employee for identification purposes, and a color photograph of the employee that clearly shows the full front of the employee’s face and that is at least 1 inch in width and 1.5 inches in height. Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 85 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.7 LABOR PEACE AGREEMENT As mandated by State Law and as a commitment to company employees, the Community Veterans of Fresno team has entered into a Labor Peace Agreement with UFCW 8-Golden State. The agreement between the Community Veterans of Fresno and UFCW emphasizes equal pay and fair treatment in the workplace regardless of gender, race, religion, sexual orientation, disability, or cultural background. Community Veterans of Fresno will work with UFCW because UFCW is a key leader in coalitions and advocacy groups that work for real change at all levels of policy. UFCW has a remarkable diversity track-record and is uniquely positioned to help Community Veterans of Fresno recruit, train, and retain a skilled and diverse workforce. In the agreement with UFCW, Community Veterans of Fresno agrees to the following terms, among others: 1. Community Veterans of Fresno will remain neutral towards UFCW’s organizing effort. In other words, Community Veterans of Fresno will not interfere with UFCW in any manner. 2. Community Veterans of Fresno will allow UFCW to come to Community Veterans of Fresno’s facility to speak with the employees during non-work hours, such as meal and work breaks, in a private, unmonitored room inside the Community Veterans of Fresno facility. 3. Community Veterans of Fresno will recognize UFCW as the exclusive representative of the Community Veterans of Fresno’s employees in a labor dispute. 4. Community Veterans of Fresno waives its right under the National Labor Relations Act to file any petition with the National Labor Relations Board for any election in any bargaining unit. Community Veterans of Fresno agrees that final and binding arbitration will be the exclusive remedy for any alleged violations. Please find attached below the executed agreement between Community Veterans of Fresno and the UFCW 8. Community Veterans of Fresno is PROUD to be a union shop – offering employees union benefits. The City of Fresno can count on this company to uplift our employees! Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 86 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 87 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Labor Peace Agreement Applicant: Community Veterans of Fresno Page 88 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Social Policy and Local Enterprise Plan Subsection: Workforce Plan Applicant: Community Veterans of Fresno Page 89 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.8 WORKFORCE PLAN Provide a workforce plan that includes at a minimum the following provisions: 2.8.1 Commitment of a Minimum 30% Local Hiring Community Veterans of Fresno will strive to hire a minimum of 50% of employees from the City of Fresno and will strive to give preference to qualified individuals who demonstrate a prior cannabis related arrest, are low income or both. A focus on local employees provides Community Veterans of Fresno a great opportunity to network within the city at large and build strong relationships with the community. The interview process will include the vetting of potential employees. This vetting will be rigorous and will follow industry standards to ensure that only the most qualified and morally upstanding candidates are selected for employment. All potential employees will first obtain a commercial cannabis employee work permit from the City prior to performing any work. Community Veterans of Fresno will cover all costs associated with this regulatory requirement. The company is committed to hiring all (or substantially all) of its employees from local Fresno residents. One of the greatest advantages of business in the economy of a city is to raise the employment level locally. In addition, other members of the business community will benefit from the design, construction and other vendor relationships required by the business. On 10/19, Community Veterans of Fresno posted a job on Indeed to find a store manager. As of 11/17 - there were 151 Active Candidates. CEO, Daniel Wise personally reviews each applicant and is providing preference to experienced Fresno residents. After reviewing the most qualified resumes, he conducts a brief interview to determine if the employee meets the high standards to become a Community Veterans of Fresno employee. 2.8.2 Commitment to Offering Apprenticeships Community Veterans of Fresno, in additional to an educational reimbursement program (see employee benefits section) will offer an extensive, continuous training program for all employees and positions, to further cannabis industry education. This cannabis focused educational program will provide employees the opportunity to not only improve their knowledge and skillset within current roles within the company, but also provide advance knowledge and skillsets required to advance within the company. Community Veterans of Fresno will encourage all team members to seek out additional opportunities to take courses, attend seminars, take online web series or classes, and more, to deepen their knowledge and skills in the cannabis industry. Community Veterans of Fresno will fully fund these educational opportunities upon enrollment, only requiring the employee to provide evidence of completion to add to their personnel file. Some educational opportunities employees may partake in include:  Oaksterdam University  THC University Online Training Courses  Cannabis Training University  Various cannabis events across Southern California Section: Social Policy and Local Enterprise Plan Subsection: Social Equity Incubator Plan Applicant: Community Veterans of Fresno Page 90 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 2.8.3 Commitment to Paying Living Wages Community Veterans of Fresno’s objective is to retain loyal employees who will provide a lot of value to Community Veterans of Fresno customers. To ensure Community Veterans of Fresno retains the most talented employees, Community Veterans of Fresno will pay each member of its team competitively. Looking towards the living wage for Fresno County minimum wage, Community Veterans of Fresno agents will be paid much higher than is required for living. Community Veterans of Fresno agents who have households with 1 adult and 0 children will make a premium of 105-241% of the Fresno County recommended living wage, and a premium of 150-233% of California’s minimum wage as illustrated below. Employee Title Hourly Rate Percentage of Living Wage Percentage of Minimum Wage Retail Store Manager $28.00 241% 233% Shift Leader $25.00 215% 208% Retail Sales Associate $18.00 155% 150% Inventory Control Specialist $18.00 155% 150% Delivery Driver $18.00 155% 150% Included with compensation, the team has additionally accounted for the associated employee benefits and the additional cost of employee background screening. Employee Salary Projections 2.9 SOCIAL EQUITY INCUBATOR PLAN Community Veterans of Fresno is committed to providing various forms of support to local cannabis social equity businesses in an effort to build a successful and compliant cannabis industry that brings to the community high quality cannabis and cannabis products. 2.9.1 Mentorship and Training Program As exemplified throughout the various sections of this application, this team holds unparalleled knowledge and experience within the cannabis industry as well as business development/management. The Community Veterans of Fresno team also share a passion around the building of a successful cannabis industry and is willing to provide several forms of mentorship, training, technical and financial assistance to local cannabis social equity businesses. 1 2 3 4 5 6 7 8 9 10 Employee Background Screeening $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 $1,380 Payroll Taxes and Benefits- Indirect $92,736 $151,296 $166,426 $174,747 $183,484 $192,658 $202,291 $212,406 $223,026 $234,178 Salary $463,680 $756,480 $832,128 $873,734 $917,421 $963,292 $1,011,457 $1,062,030 $1,115,131 $1,170,888 $- $200,000 $400,000 $600,000 $800,000 $1,000,000 $1,200,000 $1,400,000 $1,600,000 10 Year Salary Projections Section: Social Policy and Local Enterprise Plan Subsection: Social Equity Incubator Plan Applicant: Community Veterans of Fresno Page 91 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 The Community Veterans of Fresno team will create an online portal welcoming local cannabis social equity business to reach out to the ownership team to directly discuss their specific needs. The team will analyze their request and put together a specific support plan tailored for the company considering their projected goals, skills, resources, and needs. The Community Veterans of Fresno team can provide an array of services from helping develop business plans and standardized operations, to creating connections with professional vendors that can help with various elements of commercial cannabis business operations. The teams expansive experience in business ownership within the cannabis industry creates opportunities for all business types to participate in the teams Social Equity Incubator Program, not limited to retail settings only. 2.9.2 Dedicated Shelf Space to Promote Local Fresno Cultivators and Manufacturers The Community Veterans of Fresno team believes that now, more than ever, communities must stick together. Small businesses should make an active effort to support other small businesses. Daniel and Kendall believe that this is a good business practice and intends to reach out to businesses in the Fresno community to source as many products and services as possible. The Community Veterans of Fresno team values the communities understanding that without community members, strong leadership and structure, and good business practices, economies would fall and no business, big or small, would achieve the full potential of success. While the Community Veterans of Fresno team prides itself on providing the community with high quality products, the Community Veterans of Fresno team also prides itself contributing to the good and prosperity within the communities it serves. For that reason, though the team will look to source the highest quality and purest products available in the market, the team will also make every possible attempt to source products from local cultivators and manufacturers within the Fresno area. Depending on availability, the company is committed to sourcing a minimum of 50% of our products from this area. In our purchasing system, local vendors will be given a flag to demonstrate they are a preferred vendor. The Community Veterans of Fresno team will utilize the California Cannabis Portal to stay up to date on all licensed cultivators and manufacturers in the Fresno area. Applicant: Community Veterans of Fresno Page 92 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section 3: Neighborhood Compatibility Plan 3 NEIGHBORHOOD COMPATIBILITY PLAN Before After Section: Neighborhood Compatibility Plan Subsection: Addressing and Responding to Complaints Applicant: Community Veterans of Fresno Page 93 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.1 ADDRESSING AND RESPONDING TO COMPLAINTS Community Veterans of Fresno has planned its operation in a way to minimize impact to the surrounding community, however, should operations drive disruption, Community Veterans of Fresno has developed processes to collect feedback so that, as a company, they can work to quickly address issues viewed as a nuisance. Feedback will be welcomed through a couple of different means. First, Community Veterans of Fresno will appoint a Community Relations Liaison/Emergency Contact that will take point on addressing and responding to complaints associated with noise, light, odor, litter, vehicles, pedestrian traffic, and emergency situations. Community Veterans of Fresno will distribute contact information for the Community Relations Liaison, including name, telephone number, and email address throughout the community as an outlet for people to provide feedback on any concerns related to noise, light, odor, litter, vehicles, pedestrian traffic, and other emergency situations. Pursuant to FMC 9-3309(m)(1), Community Veterans of Fresno will provide the above information to all businesses and residences located within a minimum of one hundred (100) feet of the facility. 3.1.1 Community Veterans of Fresno Community Relations Designee • Name: Daniel Wise • Phone Number: 512-745-3242 • Email: danny@currntcannabis.com In full compliance with FMC 9-3309(m)(2), during Community Veterans of Fresno’s first year of operation, the owner, manager, and community relations representative from Community Veterans of Fresno’s facility will attend meetings with the City Manager or his/her designee(s), and other interested parties as deemed appropriate by the City Manager or his/her designee(s), to discuss costs, benefits, and other community issues arising as a result of implementation of commercial cannabis businesses. After the first year of operation, the owner, manager, and community relations representative from Community Veterans of Fresno’s facility will meet with the City Manager or his/her designee(s) when and as requested by the City Manager or his/her designee(s). 3.1.2 Complaint Form Community Veterans of Fresno will post a complaint form on their website. This will be utilized for collecting complaints both from the community and customers. This form will generate an email directly to the Director of Operations, who will review them daily. The Director of Operations will hold weekly meetings with the Community Veterans of Fresno team to review and discuss the complaints. Once the complaint is addressed, protocols and process documents will be revised and/or store adjustments will be made. All complaints will be recorded and kept on file and will be provided to the City of Fresno officials upon request. Community Veterans of Fresno is again, dedicated to supporting the community and will take any and all reasonable actions to minimize disruption to neighboring members of the community. Section: Neighborhood Compatibility Plan Subsection: Addressing and Responding to Complaints Applicant: Community Veterans of Fresno Page 94 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 A. Complainant: Last Name: First Name: Middle Initial: Date of Incident: Time of Incident: Can We Contact You: Home Address: Home/Cell Phone No.: Work Phone No.: Email Address: B. Did you Speak with a Community Member of Fresno Representative, if so, Please Complete Below: Last Name: First Name: Did You Speak by Phone or at the Cake Facility? Was the Representative Helpful? C. Additional Witnesses (if any): Last Name: First Name: Address: Phone No.: Email Address: Description of Incident: F. Remedy - Please describe your requested remedy G. Complainant’s Signature: Date: For Community Veterans of Fresno Use Only Complaint No.: Date Received: Section: Neighborhood Compatibility Plan Subsection: Nuisance Avoidance Policies Applicant: Community Veterans of Fresno Page 95 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.2 NUISANCE AVOIDANCE POLICIES Community Veterans of Fresno is dedicated to being an asset for the city of Fresno and good neighbors to those that surround the business. In efforts to minimize complaints or being viewed as a nuisance to surrounding businesses or residents, Community Veterans of Fresno will manage its premises in a manner that is considerate of its neighbors and local community. This includes, but is not limited to, the following: 1. Preventing and eliminating conditions on the site that constitute a nuisance. 2. Maintaining the exterior of the site, including any parking lots under the control of Community Veterans of Fresno facility, free of litter, debris, and trash. 3. Maintaining the premises and its infrastructure so that it is visually attractive and not dangerous to the health, safety and general welfare of employees, patrons, surrounding properties, and the general public. 4. Implementing measures that discourage loitering near Community Veterans of Fresno’s facility and collaborating with the City Police Department to enforce related laws. 5. Safely storing and disposing of all waste generated on the site, including chemical and organic waste, in accordance with all applicable laws and regulations. 6. Removing all graffiti from the site and parking lots under the control of Community Veterans of Fresno within 72 hours of its application. 7. Removing all litter on or around the facility on a regular basis, to include adjacent sidewalks and parking lots. In strict compliance with FMC 9-3309(b)(c) and 16 CCR § 5025(d), Community Veterans of Fresno will not cause or permit the sale, dispensing, or consumption of alcoholic beverages or tobacco products on or about the premises of the cannabis retail facility. Further, Community Veterans of Fresno will enforce a policy that strictly prohibits the consumption of cannabis or cannabis products on Community Veterans of Fresno’s premises in full compliance with FMC 9-3309(a). Finally, Community Veterans of Fresno will prohibit loitering by persons outside the facility both on the premises and within fifty (50) feet of the premises pursuant to FMC 9-3309(l) and will employ on-site security to enforce this policy. On-site security staff will diligently work to manage traffic in and out of the facility in a manner that is respectful of neighboring members of the community. It is the goal of Community Veterans of Fresno to maintain a facility, both in appearance and in operations, that drives minimal disturbances. It is the team’s experience that more often than not, customers are seeking for a comfortable and safe environment to shop, therefore, these policies are just as important to the success of the business as it is to the neighboring businesses. 3.3 ODOR MITIGATION PRACTICES Community Veterans of Fresno believes the positive benefits of actively managing air and water quality translates to the health and wellbeing of its customers and employees. Community Veterans of Fresno wants to create a space that is comfortable for customers and free of allergens while preventing any odors from reaching the outside of the facility. It is the team’s ambition to reduce the impact on the surrounding community as a whole by eliminating undesirable odors, gases, or other potential hazards with relation to air quality. Community Veterans of Fresno will incorporate the best available odor control technology and devices in the overall design of the facility to ensure that odors from cannabis are not detectable off-site. A sufficient odor absorbing ventilation and exhaust system will be provided so that odor generated inside the premises that is distinctive to its operation is not detected outside of the facility, anywhere on adjacent property or public rights-of-way, on or about the exterior or interior common area walkways, hallways, breezeways, foyers, lobby areas, or any other areas available for use by common tenants or the visiting public, or within any other unit located inside the same building as Community Veterans of Fresno’s facility. Section: Neighborhood Compatibility Plan Subsection: Potential Sources of Odor Applicant: Community Veterans of Fresno Page 96 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.4 POTENTIAL SOURCES OF ODOR Community Veterans of Fresno intends to operate a cannabis retail dispensary which will offer cannabis and cannabis infused products. In accordance with local and state law Community Veterans of Fresno will maintain all product in sealed, smell proof packaging. Community Veterans of Fresno does not intend to cultivate or process cannabis products, and pursuant to 16 CCR § 5412, all packages that arrive to the facility will arrive in sealed retail packaging, which should minimize cannabis odor within or around the facility. However, Community Veterans of Fresno understands that cannabis products naturally have a unique aroma that some may find offensive. Community Veterans of Fresno team has crafted an odor mitigation strategy that will create an environment that will be pleasant for customers and prevent the facility from becoming a nuisance to the surrounding community. 3.5 ODOR CONTROL DEVICES AND TECHNIQUES In accordance with FMC 9-3309(j), Community Veterans of Fresno will incorporate odor control devices and techniques within the facility and operational procedures to ensure that odors from cannabis are not detectable off- site. 3.5.1 Mechanical Engineer Community Veterans of Fresno will hire a qualified Mechanical Engineer to design the facilities odor control systems. The Odor Control system will be fully designed as part of the facility renovation with detailed specifications provided to the City as part of the CUP process. 3.5.2 Odor Absorbing Ventilation and Exhaust System Community Veterans of Fresno will provide a sufficient odor absorbing ventilation and exhaust system so that odor generated inside the commercial cannabis business that is distinctive to its operation is not detected outside of the facility, anywhere on adjacent property or public rights-of-way, on or about the exterior or interior common area walkways, hallways, breezeways, foyers, lobby areas, or any other areas available for use by common tenants or the visiting public, or within any other unit located inside the same building as Community Veterans of Fresno’s business. As such, Community Veterans of Fresno will install and take all measures, including installing equipment, to control odor. In order to control nuisances such as odors, humidity and mold, Community Veterans of Fresno will have the following professionally installed: • An exhaust air filtration system with odor control that prevents internal odors and pollen from being emitted externally; • An air system that creates negative air pressure between the premises' interior and exterior, so that the odors generated inside the premises are not detectable outside the premises. Community Veterans of Fresno will install a high-quality ventilation and air purification system, to ensure there is no cannabis odor outside the building. We will use industry favored and proven effective ventilation and air purification systems that will aid in maintaining a comfortable environment both for customers as well as surrounding neighbors. Cannabis products will be in sealed, smell-proof jars and packaging, which will further contribute to air quality and odor control measures. In order to provide an area that is safe and comfortable for employees as well as visitors, Community Veterans of Fresno will utilize a separate or zoned HVAC system capable of filtering the air. Such measures will include a comprehensive HVAC system that incorporates medical industry standard filtration, such as High Efficiency Particulate Air (HEPA) and High Efficiency Gas Absorption (HEGA) where appropriate. Similarly, any water entering the facility will also be filtered and, where appropriate, subjected to Ultraviolet (UV) purification. The goal is to reduce contaminants in the facility to prevent adulteration and ensure the highest quality products and experience for customers. Section: Neighborhood Compatibility Plan Subsection: Staff Odor Training and System Maintenance Applicant: Community Veterans of Fresno Page 97 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Community Veterans of Fresno will ensure that the HVAC system is an air system which creates negative air pressure to help contain odors generated inside from escaping the building and being detectable outside or by neighboring establishments. Given the unique nature of commercial cannabis retail, it is Community Veterans of Fresno’s intention to reduce odors inside where possible and eliminate any and all distinct odors from being detectable outside of the facility. These concerns have been largely mitigated in the retail environment by the pre-packaging of all products that will be available for sale. Based on solutions implemented in other industries, increasing offerings of industry specific solutions and technology will allow Community Veterans of Fresno to stay in compliance with the City of Fresno expectations. This will be generally accomplished by utilizing multiple filtrations, odor absorption and carbon “scrubbers” to rid the system exhaust of any odors. Activated carbon is an extremely effective absorptive odor control substance. An ozone generator will be placed upstream of the carbon filters. Ozone (O3) is also an effective odor control mechanism. In this case, it is used to help control out- going airstream odors and recharge the activated carbon filter media, extending the life of the media. By utilizing an efficient HVAC system that utilizes pre-filters, HEPA filters and Carbon Filters, Community Veterans of Fresno is confident that no odors will be detectable outside of the operation’s facility, anywhere on adjacent lots or public rights-of-way, on or about the exterior or interior common area walkways, hallways, breezeways, foyers, lobby areas, or any other areas available for use by common tenants or the visiting public. 3.6 STAFF ODOR TRAINING AND SYSTEM MAINTENANCE Community Veterans of Fresno understands that even a great system can become ineffective without regular maintenance and proper upkeep. In order to preserve the effectiveness of the system, Community Veterans of Fresno has developed a routine maintenance schedule that will be overseen by the Director of Security, Eugene Lineham. In addition to his security role, Eugene will manage all facility maintenance and repair needs. Specific to the HVAC and odor control system, Community Veterans of Fresno has planned the following maintenance schedule. 1 HVAC system scheduled maintenance and inspection will occur every 6 months. 2 HEPA, prefilters, and carbon filters will be replaced every 60 days. While traditionally an HVAC system only requires annual service and inspection, Community Veterans of Fresno wants to ensure that all systems remain fully operational and effective at both maintaining a comfortable environment as well as minimizing odors within the facility. HEPA, prefilters, and carbon filters are typically changed every six months for common use, however, to ensure that odors are never detectable, Community Veterans of Fresno feels it is important to change them in advance. These maintenance activities will be evaluated regularly and adjusted if odors become detectable within or around the facility. All repairs will be immediately scheduled with the HVAC professional upon discovery of faulty equipment. Section: Neighborhood Compatibility Plan Subsection: Staff Odor Training and System Maintenance Applicant: Community Veterans of Fresno Page 98 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.6.1 Odor Control Administrative Controls To ensure the efficacy of the odor control plan, Community Veterans of Fresno will maintain records of all maintenance and repair activities related to odor control equipment. Each service and filter replacement will be logged in the facility maintenance log noting the date, activity performed, and initials of the agent overseeing the activity. The Retail Store Manager will undergo training on facility maintenance activities and receive standard operating procedures on how to perform filter replacements in the event that Eugene is not available to perform a regularly scheduled activity. The Maintenance Log will also note the next required date of service. The Retail Store Manager will be responsible for tracking service dates, managing professional service visits and repairs, and updating the maintenance log. Appointments and required equipment, such as replacement filters will be scheduled or ordered upon the determination of next requested service date to ensure that service dates are not extended to availability issues. Maintenance Log (Example) Facility Maintenance Log Date Equipment Serviced Service Performed Technician/Agent Date of Next Service Required 1/1/21 HVAC System Installation Paul International Inc 6/1/21 – Routine Inspection 1/1/21 HVAC Filters Installation Paul International Inc 3/1/21 – Filter Replacement 3/1/21 HVAC Filters Replacement Eugene Lineham 5/1/21 – Filter Replacement Section: Neighborhood Compatibility Plan Subsection: Waste Management Plan Applicant: Community Veterans of Fresno Page 99 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.7 WASTE MANAGEMENT PLAN While it is the intent of Community Veterans of Fresno to achieve a Zero Waste operation, the team wants to ensure that Community Veterans of Fresno is in compliance with all local, County, State, and Federal requirements for solid waste and hazardous waste disposal. The team has crafted a Waste Management Plan that accounts for these rules as well as drive the behaviors that will help the company work toward a Zero Waste goal. Community Veterans of Fresno will welcome the County of Fresno Environmental Health Division or City Manager to inspect the facility at any time during business hours to ensure compliance. For the purposes of our Waste Management Plan, waste is divided into the following categories: • Solid Waste • Recycling • Organic Waste • Electronic Waste • Compostable Cannabis Waste • Non-Compostable Cannabis Waste It is the company’s goal to not only understand the importance of the various types of waste, but to properly implement sorting procedures to ensure that each type of waste is properly disposed of. Each type of waste will have a designated bin that is properly labeled to ensure employee compliance. Community Veterans of Fresno will utilize a sorting system with customer education signs to ensure all waste is responsibly managed. 3.7.1 Single Use Carryout Bag Community Veterans of Fresno will not provide plastic carryout bags to customers at the point of sale. The prepackaged, childproof, and sealed products will be placed in a drawstring, recyclable bag upon purchase. 3.7.2 Solid Waste Management For waste that is not cannabis waste, Community Veterans of Fresno will engage the franchise exclusively used for collecting and hauling commercial solid waste and recycling material in the City of Fresno, Mid Valley Disposal. Mid Valley Disposal has become one of the greenest companies in the Central Valley. Beyond solid waste management, the Community Veterans of Fresno team will work directly with Mid Valley Disposal for all recycling, organic waste, and electronic waste disposal. 3.7.3 Recycling In alignment with the City’s recycling efforts, Community Veterans of Fresno will implement a recycling program. Recycling bins will be located throughout the facility to ensure that employees and patrons have easy access to recycle items such as newspaper, cardboard, aluminum cans, and bottles. Community Veterans of Fresno has reviewed each recyclable item to identify the proper strategy to recycle these items. Community Veterans of Fresno will engage Mid Valley Disposal for the collection of the company’s recyclables. Section: Neighborhood Compatibility Plan Subsection: Waste Management Plan Applicant: Community Veterans of Fresno Page 100 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.7.4 Organic Waste California requires mandatory organics recycling for businesses who generate more than 2 cubic yards per week to recycle organic waste. While Community Veterans of Fresno does not expect to generate more than 2 cubic yards of solid waste per week, the team understands their obligation to participate in this program. Mid Valley Disposal recently implemented a full organics program for disposal of all green waste and organics that Community Veterans of Fresno will implement within the facility. Community Veterans of Fresno does not anticipate that the company will generate much Organic Waste. The company’s organic waste would be limited to food items during an employee’s break. Additionally, there is a chance that expired edibles would generate organic waste that is compostable. In the process below, Community Veterans of Fresno has developed a process to render this waste unusable. It is our hope that Mid Valley Disposal will accept the facility’s compostable cannabis waste. Section: Neighborhood Compatibility Plan Subsection: Waste Management Plan Applicant: Community Veterans of Fresno Page 101 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.7.5 Electronic Waste All Electronic Waste will be sorted and disposed of properly. As part of the many services offered through Mid Valley Disposal, upon special request, they will collect electronic waste. The Community Veterans of Fresno will engage Mid Valley Disposal when needed to collect this type of waste to further do their part in the diversion of waste. This includes monitors, televisions, CRTs, computers, thumb-drives, cameras, or any other electronic devices. 3.7.6 Construction Waste and Debris As Community Veterans of Fresno does plan on retrofitting an existing structure for the development of the state of the art facility being promised to the City of Fresno, this is likely to generate construction and demolition debris. Although this type of waste is often overlooked in a company’s waste management plan, Community Veterans of Fresno, often construction and demolition projects are an incredibly large percent of the waste stream of any city. The Cal Green Code requires any construction and demolition project to meet a 65% diversion rate, therefore, the Community Veterans of Fresno will further engage with Mid Valley Disposal for participation in their construction and demolition debris recycling program. It is the hope of Community Veterans of Fresno to divert as much waste as possible and promotes a culture within its facility that drives employees, consumers, and daily operations to consider the three “R” of sustainability. 3.7.7 Employee Education In order to encourage employee compliance, Community Veterans of Fresno will post this educational poster in the company breakroom. The Store Manager will be responsible for enforcing compliance. Section: Neighborhood Compatibility Plan Subsection: Waste Management Plan Applicant: Community Veterans of Fresno Page 102 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 3.7.8 Cannabis Waste In the event that Mid Valley Disposal will not accept our cannabis compostable waste, Community Veterans of Fresno has identified Ecowaste to haul away any and all cannabis waste. This company has been operating since 2016 and offers a legally compliant solution to hauling cannabis waste and is committed to operating within the rules set forth by 16 CCR § 5055. Destruction of Product If any of Community Veterans of Fresno’s cannabis product becomes contaminated, recalled, expired, or otherwise rendered unusable, Community Veterans of Fresno will dispose of the cannabis or cannabis product. Community Veterans of Fresno’s Track and Trace Manager will always be present and oversee any destruction of product and ensure that it is properly recorded. Additionally, Community Veterans of Fresno asserts that cannabis waste will never be sold for any reason. Green Cycler Composter Community Veterans of Fresno will use a composter to render cannabis unusable. This product is a small appliance that chops up compostable items into an odor-free container. It is capable of shredding plant-based items, including cannabis. The Green Cycler has a specialized ventilation system that optimizes air flow to neutralize odor causing bacteria. Process to Render Waste Unusable – Compostable Community Veterans of Fresno has prepared the following process to render waste unusable. This will occur on a weekly basis and be conducted by the Inventory Control Manager while under video surveillance. 1 Identify products in the quarantine area ready for disposal. 2 Sort Compostable and Non-Compostable Waste. 3 Remove Compostable Waste from packaging. 4 The Inventory Control Manager will weigh the product and generate an inventory record in the inventory management system and METRC. 5 The marijuana is emptied into the Green Cycler and mixed with the following: a. Food waste, b. Yard waste, or c. Vegetable based grease or oils 6 The Inventory Control Manager will pour an equal amount of Vegetable Oil into the Green Cycler. a. For instance, if 1 ounce of marijuana is being rendered unusable, 1 ounce of Vegetable Oil will be mixed into the container. 7 Using the lever on the Green Cycler, the Inventory Control Manager will destroy the compostable cannabis waste. 8 The Inventory Control Manager will repeat this process until all quarantined items are rendered unusable. 9 Upon completion, the Inventory Control Manager will empty the container in a biodegradable bag. 10 This bag will be placed inside the Waste Receptacle Labeled “Compostable Mixed Waste”. 11 A permitted waste company will be contacted to pick-up the waste for transport to a compost or anaerobic digester facility. Process to Render Waste Unusable –Non-Compostable 1 Identify products in the quarantine area ready for disposal. 2 Sort Compostable and Non-compostable Waste. 3 Remove Non-compostable Waste from packaging. 4 The Inventory Control Manager will weigh the product and generate an inventory record in the inventory management system and METRC. 5 The Non-compostable Waste is emptied into the Green Cycler. Section: Neighborhood Compatibility Plan Subsection: Waste Management Plan Applicant: Community Veterans of Fresno Page 103 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6 Using the lever on the Green Cycler, the Inventory Control Manager will destroy the Non-compostable Cannabis Waste. 7 The Inventory Control Manager will repeat this process until all quarantined items are rendered unusable. 8 The Inventory Control Manager will take shredded paper from the office and mix that with the Non- compostable Cannabis Waste. 9 Upon completion, the combined waste will be placed into a biodegradable bag. 10 This bag will be placed inside the Waste Receptacle Labeled “Non-Compostable Cannabis Waste”. 11 A permitted waste company will be contacted to pick-up the waste for transport to a landfill or incinerator. 3.7.9 Waste Storage Receptacles Community Veterans of Fresno will put cannabis waste into 2 Waste Storage Receptacles, 1 for Compostable Cannabis Waste and the other for Non-Compostable Cannabis Waste. These will be locked inside the cannabis storage vault. The storage receptacles will be bagged and stored in a locked 65-gallon waste containers. Waste equipment will be managed in a way that will prevent the unintentional conveyance of waste outside the storage area. The Waste Storage Receptacle will have the following features: 1 Constructed to be easily handled for collection; 2 Constructed of rust resistant and corrosion resistant materials; 3 Equipped with a tight fit lid or cover; 4 Watertight, leak proof, insect proof and rodent proof; and 5 Clearly marked “Cannabis Waste.” 3.7.10 Cannabis Waste Storage Area Pursuant to 16 CCR § 5055(c)(3), Community Veterans of Fresno will establish a secure waste storage area where physical access is restricted to select Applicant employees. Additionally, this area is designed to store all waste both inside and outside the facility in a manner designed to prevent cross-contamination, and which minimizes safety hazards, odors, dust, unsightliness, and other nuisances. Outside the facility, Community Veterans of Fresno will utilize a locked dumpster adjacent to the facility to store waste. Community Veterans of Fresno will store waste in a way that does not create a risk of fire, explosion, or the accumulation of poisonous or otherwise harmful vapors or gases. Community Veterans of Fresno will not generate hazardous waste or mix cannabis waste with hazardous material. The Cannabis Waste Storage Area will be subject to daily routine inspection. Community Veterans of Fresno team will routinely clean the area and inspect for insects, rodents, birds, contaminants, and adulterants. The discovery of any insects, rodents, or other pests will warrant immediate action and extermination using a California exterminator. Unless there is a spill or other event requiring more frequent sanitation, Community Veterans of Fresno will clean and sanitize all areas where cannabis is stored, both inside and outside, on a weekly basis. 3.7.11 Track and Trace Destruction Procedure When cannabis must be disposed or destroyed, Community Veterans of Fresno will generate a record in the inventory management system and METRC of the destruction or disposal. Community Veterans of Fresno will ensure that all waste and unusable products are weighed, recorded, and entered in the inventory system prior to mixing and disposal. Verification of this event will be performed by a supervisor and conducted in an area with video surveillance. The Inventory Control Agent will be responsible for the destruction of cannabis waste. Upon identifying a need to destroy cannabis, the agent will create an inventory record in COVA to designate the destruction activity. Pursuant to 16 CCR § 5049(7), each destruction record will track the following: Non-Compostable Cannabis Waste Compostable Cannabis Waste Section: Neighborhood Compatibility Plan Subsection: Waste Management Plan Applicant: Community Veterans of Fresno Page 104 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 1 The name and employee identification number of the individual who performed the destruction or disposal. 2 The reason for destruction or disposal. 3 The name of the entity being used to collect and process the cannabis waste. 4 A description of any adjustments made in the statewide track and trace system, including, but not limited to: 5 Spoilage or fouling of the cannabis goods. 6 Any event resulting in exposure or compromise of the cannabis goods. 7 Any other information required by the Bureau. 3.7.12 Hauling Cannabis Waste Upon arranging for the pickup of cannabis waste by an approved waste hauler or when depositing cannabis waste at a Bureau- approved waste handling facility, Community Veterans of Fresno will obtain and keep a record from the solid waste facility or other approved waste handling operation evidencing the acceptance of the cannabis waste material at the facility. Pursuant to 16 CCR § 5055(e)(3)(A), Community Veterans of Fresno will ensure that the record contains the following information: 1 The name of the facility where the cannabis waste was deposited; 2 The address of the facility; 3 The date and time the waste was accepted by the facility; The volume or weight of the cannabis waste accepted. Applicant: Community Veterans of Fresno Page 105 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section 4: Safety Plan 4 SAFETY PLAN Section: Safety Plan Subsection: Professional Fire Prevention and Suppression Consultant Applicant: Community Veterans of Fresno Page 106 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.1 PROFESSIONAL FIRE PREVENTION AND SUPPRESSION CONSULTANT Community Veterans of Fresno has partnered with Dr. Gantt, an experienced Safety Engineer and Board-Certified Safety Professional, in the advisement and preparation of a comprehensive Safety Plan for the facility. Safety Compliance Management, Inc. (SCM), a safety and health consultation firm headquartered in San Ramon, California and founded by Dr. Paul Gantt. Dr. Gantt is a Safety Engineer with a Doctorate degree in Human Services and is a Board-Certified Safety Professional (CSP). He is also certified by the Office of the California State Fire Marshal as a Certified Fire Officer, Certified Fire Prevention Officer, Certified Public Education Officer, Certified Fire Training Officer, and is certified to teach many of these disciplines for the Office of the State Fire Marshal. Dr. Gantt is an experienced Safety Engineer and Board-Certified Safety Professional (CSP) with an extensive background as both a regulator and in private practice encompassing over 40 years. He is experienced in many areas of occupational and construction safety, safety systems and programs, multi-employer worksites, fire and life safety, workplace and premises evaluation and liability, general safety practices, OSHA and Cal-OSHA health and safety regulations, and Fire and Building Code safety and health requirements. He has considerable experience inspecting and evaluating construction sites, occupational settings, and conducting safety assessments in a broad range of public and private facilities. Additionally, his expertise includes the delivery of training programs with the ability to explain complex regulations, hazards, and practices in an easy-to-understand manner that can be essential in testimony and reports. He is a nationally recognized speaker in many areas related to occupational health and safety, fire safety, premises safety, and regulatory compliance. After consulting with the Community Veterans of Fresno team, reviewing building plans and related documents, and obtaining information specific to the activities that will take place within the facility, Dr. Gantt has provided a preliminary report providing the team of Community Veterans of Fresno with his evaluation and recommendations related to the plans and programs required to ensure a safe facility for both employees and the general public. Dr Gantt’s report considered all relevant codes including the 2016 edition of the California Building Code (CBC), the 2016 edition of the California Fire Code (CFC), the current California Health and Safety Code, and applicable Cal/OSHA regulations found in Title 8 of the California Code of Regulations (8 CCR). The team has reviewed the report and will incorporate it elements into the design of the facility as well as the general operation and policies utilized at the facility. Below is a resume that details Dr. Gantt full list of credentials and experience. Section: Safety Plan Subsection: Professional Fire Prevention and Suppression Consultant Applicant: Community Veterans of Fresno Page 107 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Safety Plan Subsection: Professional Fire Prevention and Suppression Consultant Applicant: Community Veterans of Fresno Page 108 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section: Safety Plan Subsection: Accident and Incident Reporting Procedures Applicant: Community Veterans of Fresno Page 109 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.2 ACCIDENT AND INCIDENT REPORTING PROCEDURES 4.2.1 Fire and Life Safety Coordinator Community Veterans of Fresno has designated Daniel Wise as the Fire and Life Safety Coordinator for the organization. The Fire and Life Safety coordinator is responsible for the planning, evaluation, and execution of the EAFPP and should perform the following duties: 1. Review and update the EAFPP annually or as needed. 2. Conduct annual facility evacuation drills. Know the location of all fire extinguishers; pull alarms, and first aid kits. Ensure evacuation routes are posted and walkways remain clear at all times. 3. When an emergency alarm has been sounded, systematically check all areas to assure everyone has been evacuated. 4. If needed, post assistants along the evacuation route to guide people to the Assembly Area. 5. Take roll call at the assembly area following a site evacuation to ensure the safety of all employees. 6. Assist mobility impaired persons to evacuate safely. 7. Keep people calm and informed. 8. Report to the Co-Presidents, Security Manager, or the on-scene Incident Commander. 9. If ordered by on-scene Incident Commander, move all people to the Assembly Area and inform people when it is safe to re-enter buildings. After a major earthquake, a person may not re-enter buildings until cleared by a qualified building inspector. 10. After the emergency incident has concluded, the Safety Coordinator will distribute and collect After Action Report Forms completed by employees and determine potential improvements for the EAFPP. The Fire and Life Safety Coordinator directs the day-to-day prevention and safety activities at Community Veterans of Fresno. The Fire and Life Safety Coordinator is responsible for the following: • The regular inspection and maintenance of all emergency lighting, alarm, detection and suppression equipment according to manufacturer’s specifications. • Assigning someone to The Fire and Life Safety Coordinator will be familiar with: • Major workplace hazards. • Requirements to maintain aisles and exits. • Proper handling and storage practices of potential flammable and combustible materials, and ignition sources. • Community Veterans of Fresno’s Emergency Action Plan. • Laws and local codes relating to fire prevention. • All fire protection equipment. The Fire and Life Safety Coordinator is responsible to ensure all employees are trained on fire prevention housekeeping procedures and the parts of this plan that apply to them. Section: Safety Plan Subsection: Accident and Incident Reporting Procedures Applicant: Community Veterans of Fresno Page 110 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.2.2 Emergency Roll Call Sheet The Fire and Life Safety Coordinator is responsible for maintaining a current list of personnel at the facility on this form, retrieving this form during an emergency, and tracking where people are during an emergency. Name Phone Number Status or Location Emergency Contact Information • Emergency - 911 • State Center Community College District Police Department o 24-hour non-emergency Dispatch: (559) 244-6140 • California Highway Patrol - (800) 835-5247 4.2.3 After Action Report Form The Safety Coordinator is responsible for distributing these forms after an incident has concluded, to all employees who were on Community Veterans of Fresno property at the time of the incident. After employees complete these forms, the Safety Coordinator will collect them, analyze the responses, and determine potential improvements to be made to the EAFPP. 4.2.4 Reporting A Fire In the event of a fire, visible smoke, or the smell of smoke, employees must leave the area of the fire immediately! When customers are in the facility, the employees will assist them to the exits and out of the building. They will assist those in danger if it is safe to do so and help direct them out of the building and to a safe location. This should only be attempted if it does not endanger other lives. Immediately report any size fire to the fire department. Section: Safety Plan Subsection: Accident and Incident Reporting Procedures Applicant: Community Veterans of Fresno Page 111 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.2.5 Reporting an Emergency Call 9-1-1 or (559) 244-5911 from a cell phone. For any emergency, whether at work or home, employees should be prepared to provide the emergency operator with the following information: • Type of emergency. • Scope of emergency (number of people involved, size of the problem). • Location of the emergency (be as specific as possible). • Caller’s name and phone number. • Any other details emergency response personnel should be aware of. Stay on the line until the emergency operators indicate they have all the necessary information. Let the emergency operators be the first to hang up. 4.2.6 OSHA Reporting Requirements In the event of a serious occupational injury or illness, or the death of an employee as a result of an occupational condition or incident, the Labor Code requires that CAL/OSHA be notified of the occurrence by telephone immediately, no more than eight hours after the incident, or as soon as it is known the employee will be hospitalized for more than 24 hours for other than observation. The only exception would be when the person making the report can demonstrate that exigent circumstances existed, and that, even with diligent inquiry, the information for the report was not available in the required time frame. The local Cal/OSHA office number is (559) 445-5302. The following information must be reported: • Date and time of the incident. • Employer's name, address, and telephone number. • Name and job title of the person making the report. • Address of the site of the accident or event. • Names of the injured/ill employee, the person making the report, and the employer. • Nature of the injury/illness. • Location to where the injured employee(s) was (were) moved. • List and identify of other law enforcement agencies present at the site of the accident. • Description of the accident and whether the accident scene had been altered. A serious injury or illness is defined in Title 8, Section 330(h) and occurs when any of the following occur: • A fatality. • An employee suffers a loss of any member of the body. • An employee suffers a serious degree of permanent disfigurement. • An employee is hospitalized for “other than medical observation.” • A significant injury or illness diagnosed by a physician or other licensed health care professional. Section: Safety Plan Subsection: Evacuation Routes Applicant: Community Veterans of Fresno Page 112 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.3 EVACUATION ROUTES 4.3.1 ADA Compliant Evacuation Procedures Posted signage for exiting should have Braille instructions for persons with visual impairments. • Signage for emergency exiting and instructions should be in colors easily recognizable by persons with color blindness. • Evacuation familiarization tours will be provided for any employee with a visual impairment upon request. In addition to loud alarms to announce emergency evacuations, strobe lighting may be used to signal those with hearing impairments. • Employees may be assigned to assist those with hearing impairments, including customers, to ensure they are alerted to any emergency instructions. • Employees with hearing impairments may receive instructions by texts or emails. • Employees or customers with mobility impairments will be assisted to the evacuation assembly area. Section: Safety Plan Subsection: Evacuation Routes Applicant: Community Veterans of Fresno Page 113 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.3.2 Evacuation Route Diagram Section: Safety Plan Subsection: Location of Fire Extinguishers and Other Fire Suppression Equipment Applicant: Community Veterans of Fresno Page 114 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.4 LOCATION OF FIRE EXTINGUISHERS AND OTHER FIRE SUPPRESSION EQUIPMENT Community Veterans of Fresno will ensure all necessary steps are taken to maintain the safety of employees, customers, and the facility in the event of a fire. The Community Veterans of Fresno team has incorporated fire safety into the overall design and layout of the facility. This includes basic housekeeping policies that minimize fire hazards, the installation of fire suppression equipment throughout the facility, and the preparation of standard operating procedures that will prepare employees for quickly responding to fire related events. 4.4.1 Potential Fire Hazards Minimal amounts of hazardous products will be kept on site for cleaning purposes only. 4.4.2 Suppression Systems Fire Extinguishers: • Fire extinguishers are located throughout the facility to ensure that they are within 75 feet of all areas. This is necessary to allow them to be accessed and used when a small fire is discovered. • Fire extinguishers require some periodic inspection and maintenance. Fire extinguishers will be visually inspected every month and the inspection documented. • All extinguishers shall be serviced annually by an approved contractor and following each use. 4.4.3 Automatic Fire Sprinklers: When exposed to heat, the individual sprinkler head works to extinguish the fire through the application of water from the head that is exposed to the heat. The activation of a sprinkler will also sound an audible alarm and will notify the alarm company who will in turn notify the fire department. • Each individual sprinkler head must be unobstructed, so it can detect the presence of a fire and extinguish it at the earliest possible moment. • At no time shall storage come within 18 inches of any sprinkler head since this could obstruct the operation of the system. • In order to ensure proper operation, Automatic Fire Sprinkler Systems require periodic inspection and maintenance. The system will be inspected and serviced quarterly by an authorized technician and a written record will be available documenting the findings. • The system must be tested and certified every five years by a licensed technician. 4.4.4 Other Fire and Life Safety Equipment Alarms: Community Veterans of Fresno plans to provide for the safety of their employees and customers with the installation of a monitored alarm system that will be monitored by ADT alarm company. Verbal communication can also be used to provide separate notifications for full evacuations and sheltering in place. • Any manual alarm stations for use in conjunction with employee alarm systems will be unobstructed, conspicuous, and readily accessible. Any pull stations are maintained by the building leasing company. • The alarms will be tested regularly and serviced according to manufacturers’ recommendations. • Emergency Lighting: Emergency lighting will be maintained and tested according to manufacturers’ recommendations and CFC requirements. 4.4.5 Housekeeping Procedures • Fire doors shall be kept closed at all times unless provided with alarm actuated, self-closing hardware. • Maintain a minimum of three feet clearance around/ in front of all electrical panels. • Extension cords shall not be used in place of fixed wiring and shall only be used for temporary purposes. • Multi-plug adapters shall not be used unless provided as part of a listed and fused power strip. They must be plugged directly into an approved receptacle. Section: Safety Plan Subsection: Location of Fire Extinguishers and Other Fire Suppression Equipment Applicant: Community Veterans of Fresno Page 115 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 • Electrical cords shall not be placed under carpets or through doorways. • Any fire protection equipment including fire extinguishers, shall not be blocked. • All combustible storage shall be stored in a manner to prevent the spread of fire. • All combustible waste shall be stored in approved waste containers. • All work areas will be kept free of excess accumulations of waste. • Smoking will only be allowed in designated areas. Whenever smoking materials are discarded, they should be placed in appropriate, designated containers. 4.4.6 Aisles and Exits All aisles and exits shall conform to minimum standards as outlined by fire and building codes applicable to the facility. The Fire and Life Safety Coordinator will ensure that all workers assist in the maintenance of aisles and exits in their respective workplaces. It is the responsibility of the Fire and Life Safety Coordinator to ensure that aisles and exits remain free of obstructions at all times. • Storage is not permitted in emergency exit paths even on a temporary basis. • Any operation that blocks or makes an emergency exit inoperable must receive the approval of the Fire and Life Safety Coordinator or his designee. Special arrangements shall be made to ensure adequate exiting during the temporary operation. • Exit signs shall be posted above all emergency exits. Signs that are designed to be illuminated shall be maintained in proper working order at all times. • Cords and cables shall not lay across aisles where they might present a tripping hazard. • Aisles in the office area shall be maintained at a minimum of 36 inches wide. • Spills of any liquids in aisles should be cleaned up as soon as possible. • Door hardware, including locks, bolts, chains, etc., shall not be added to any exit door without the approval of the Fire and Life Safety Coordinator. • Exit doors and hardware shall be inspected as part of the regular Safety Inspection. Section: Safety Plan Subsection: Fire and Medical Emergency Training and Procedures Applicant: Community Veterans of Fresno Page 117 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 4.5 FIRE AND MEDICAL EMERGENCY TRAINING AND PROCEDURES All Community Veterans of Fresno personnel will be trained on safety policies and protocols. In the event of an environmental emergency, such as a fire, staff will be instructed on the use of fire suppression equipment and provided contact information beyond calling 911, to obtain help from professionals when required. All medical emergencies will be dispatched to local emergency staff immediately upon knowledge of any such emergency. First-Aid and CPR training will be provided for each employee, so all staff members will be able to assist, when necessary, as they wait for emergency response teams. Below, the team has outlined all occupational safety, health, and inspection programs that will be implemented at the facility. 4.5.1 Training Programs Full implementation of the occupational safety and health programs requires training in several areas. Following is a description of the training programs that have been identified. Training Description Employees IIPP training Training in accordance with 8 CCR §3203 on all elements of the IIPP and responsibilities for each level of employee within the organization. All employees Emergency Action Plan Training on the elements of the site Emergency Action Plan in accordance with 8 CCR §3220 including employee responsibilities and procedures for reporting emergencies, the emergency action to be taken for each type of anticipated emergency, and evacuation routes and areas of safe refuge. Emergencies that are covered in the training and Plan include medical, fire, earthquake, workplace violence and active shooter. All employees Inspection programs Training will be provided to personnel involved in the inspection of safety equipment and emergency systems involved in the retail activities. Affected/involved employees Equipment Specific/Job Training Training of personnel in the safe operations of all equipment used by employees as required by 8 CCR §3203. Affected/involved employees Cal/OSHA General Industry 30-hour course In accordance FMC 9-3316(c) and Section 26051.5(11)(A) of the Business and Professions Code, as may be amended, Community Veterans of Fresno asserts that within one year of receiving a commercial cannabis business permit, one supervisor and one employee will successfully complete a Cal-OSHA 30-hour general industry outreach course offered by a training provider that is authorized by an OSHA Training Institute Education Center. At least one supervisor and one employee Section: Safety Plan Subsection: Fire and Medical Emergency Training and Procedures Applicant: Community Veterans of Fresno Page 118 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Additionally, while not required, training in the following areas has been identified for the firm’s occupational safety and health training matrix. Training Description Employees Cardiopulmonary Resuscitation (CPR) and First Aid Training in accordance with 8 CCR §3400 to provide CPR and First Aid in accordance with the guidelines of the American Heart Association. Emergency Response Team (ERT) members Automatic External Defibrillator (AED) Training in accordance with 8 CCR §3400 to use an AED in accordance with the guidelines of the American Heart Association. Emergency Response Team (ERT) members Portable fire extinguisher use/Incipient Fire Control Training in accordance with 8 CCR §6151 on the use of portable fire extinguishers including requirements for notification and evacuation prior to use, selection of the proper type of extinguisher, inspection/service requirements, and proper use. Emergency Response Team (ERT) members Inspection Programs As safety systems are implemented, inspection and testing programs are required to ensure that the equipment and systems are properly maintained and useable. Required inspections are as follows. Equipment/System Frequency Portable fire extinguishers Visual inspection monthly by site personnel. Annual service by a licensed vendor. Emergency lighting systems Testing for 30 seconds monthly by site personnel. 90-minute test annually by site personnel. First Aid Kits Regular inspections of inventory by site personnel or a vendor. Portable ladders (if used) Regular inspections – recommended quarterly. Detection and alarm systems Maintained and tested in accordance with manufacturer’s and CCR Title 19 requirements. Recordkeeping To ensure ongoing compliance within the safety systems, records will be developed and maintained in compliance with Cal-OSHA requirements found in 8 CCR §§3203 and 3204, and other equipment-specific sections. Following is a list of the records that may be required. As with some of the other required safety elements, these are similar to those that are required and identified in the report. • Personnel safety training records. • Equipment inspection records. • Facility inspection records. • Operational and facility inspection records. • Emergency equipment inspection records (e.g. alarms, detectors, fire extinguishers, emergency lighting, etc.). • OSHA Log 300 and 300A. Applicant: Community Veterans of Fresno Page 119 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 5 SECURITY PLAN The Community Veterans of Fresno features a top of the line security plan. Designed by experienced professionals. Supported with state-of-the-art equipment. Section: Location Subsection: Employee Security Education Applicant: Community Veterans of Fresno Page 160 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6 LOCATION Applicant: Community Veterans of Fresno Page 160 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 Section 6: Location 6 LOCATION Section: Location Subsection: Description of Location Applicant: Community Veterans of Fresno Page 161 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6.1 DESCRIPTION OF LOCATION Community Veterans of Fresno’s proposed retail dispensary is in a prime location on E McKinley Avenue. Community Veterans of Fresno’s retail dispensary is located at 3034 E. McKinley Avenue in a commercial area within Fresno’s 7th District. This area offers several ideal conditions to the successful commercial cannabis operation and the Community Veterans of Fresno team is more than excited about this unique opportunity. Some benefits to this location are:  The property is properly zoned and permitted for commercial cannabis use and compliant with requirements regarding proximity to sensitive use areas.  As the property is located in a developed commercial area, the facility is conveniently located for customers who wish to shop at facilities which are located on regularly traveled routes.  The facility is located just off Yosemite Freeway making it easily accessible without driving traffic to rural or residential areas.  The proposed property offers amble space to create adequate parking conditions to ensure proper management of traffic in and out of the facility without creating disruptions to nearby roadways or surrounding business parking.  Surrounding commercial business will benefit from additional traffic brought in by the dispensary.  Being that the facility is close in proximity to other commercial retail facilities provides additional safeguards to security as other facilities maintain outdoor lighting a security that will also act as a deterrent to crime. Section: Location Subsection: Description of Location Applicant: Community Veterans of Fresno Page 162 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6.1.1 Overall Condition of the Property Pursuant to FMC 9-3307(d)(e), Community Veterans of Fresno’s proposed facility meets or exceeds the following structural and design requirements: Description of Structural and Design Requirement Condition Met The structure located at 3034 E. McKinley is a fully enclosed building and the Community Veterans of Fresno team will ensure cannabis is not visible from the public right-of-way. Conforms with the General Plan, any applicable specific plans, master plans, and design requirements. Current and future conditions comply with all applicable zoning and related development standards set forth for properties zoned C-G and pursuant to FMC 9- 3307(a), is appropriately zoned for commercial cannabis business. In the retrofitting process, Community Veterans of Fresno will implement the best available odor control technology that prevents odors to surrounding uses. Although the facility already exists and is consistent with surrounding properties in the area, Community Veterans of Fresno plans to update the facility in a way that promotes quality design and construction, to improve its overall appearance. The proposed property offers a total of 5,850 sq. ft of commercial space, with an existing structure that is 2,501 sq ft. This footprint is adequate in size and shape to accommodate Community Veterans of Fresno’s the establishment of developmental requirements including yards, walls, fences, parking and loading facilities, landscaping and all items required for the development. East McKinley Avenue is a 4 lane road with adequate width to accommodate any addition to the kind and quantity of traffic the facility may generate. The existing structure is already being provided with adequate electricity, sewerage, disposal, water, fire protection and storm drainage facilities required for its operation. Community Veterans of Fresno will implement operational policies and security to ensure activities that occur at the facility are not detrimental to the public health, safety, convenience, or welfare of persons residing, working, visiting, or recreating in the surrounding neighborhood and will not result in the creation of any kind of nuisance. Community Veterans of Fresno partners with design professionals regarding the façade, landscaping, and interior design of the facility to ensure that the overall look and feel of the facility seamlessly integrates in the community as well as meets all local and state code in regard to building, mechanical, safety and security regulations. Community Veterans of Fresno will research and adhere to all applicable zoning and related development standards. Demonstration of compliance can be seen in the companies site plan, this includes but is not limited to, parking, lighting, building materials, and colors. Signage, as described below, will be limited to that needed for identification only and will not contain any logos or information that identifies, advertises, or lists the services or the products offered. Section: Location Subsection: Description of Location Applicant: Community Veterans of Fresno Page 163 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6.1.2 Physical Location Community Veterans of Fresno’s proposed facility is located in Fresno’s Council District 7 in an area with a zoning determination of C-G which is allowable for commercial cannabis activities pursuant to FMC 9-3307(a). 6.1.3 Radius Map Further, pursuant to FMC 9-3307(c), Community Veterans of Fresno’s facility is not located within eight hundred (800) feet from any property boundary containing any of the following uses: • A cannabis retail business. • A school providing instruction for any grades pre-school through 12 (whether public, private, or charter, including pre-school, transitional kindergarten, and K-12). • A day care center licensed by the state Department of Social Services. • A youth center. Section: Location Subsection: Description of Location Applicant: Community Veterans of Fresno Page 164 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6.1.4 Opportunity Zone Community Veterans of Fresno’s retail facility on McKinley Avenue is actually considered an Opportunity Zone. Opportunity Zones are census tracts that are defined by the Internal Revenue Service (IRS) as: “Economically-distressed communities where new investments, under certain conditions, may be eligible for preferential tax treatment.” These distressed census tracts are characterized by a high rate of poverty, low median family income, and high rate of unemployment. In order to select the communities that would benefit the most from new investments, the federal government sought local input. The governor or chief executive of each state or territory submitted zone nominations to the Treasury Department, which then certified and designated the official Opportunity Zones. The goal? To incentivize investors to fund long-term projects in high-need areas. Specifically, Opportunity Zones provide a tax incentive for investors to reinvest unrealized capital gains—the profits from the sale of a property or investment—into Opportunity Funds. An Opportunity Fund is a privately managed investment vehicle, organized as a corporation or partnership, with the specific purpose of investing in qualified Opportunity Zone property. When the Investing in Opportunity Act became law in December 2017, the intent was to encourage long-term investment in low-income communities by providing tax incentives for investors. The first Opportunity Zones were designated in April 2018 and covered parts of 18 states; now, there are more than 8,700 Opportunity Zones in all 50 states as well as in Washington, D.C., and five U.S. territories. The Community Veterans of Fresno team is excited to be part of a program that aim boost both the economy and the employment in a depressed area. Provided below is an image of the Opportunity Zone Map revealing that the Community Veterans of Fresno’s facility falls within the described area12. 12 https://opzones.ca.gov/oz-map/ Section: Location Subsection: Description of Location Applicant: Community Veterans of Fresno Page 165 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6.1.5 Signage Community Veterans of Fresno will ensure that the original copy of the commercial cannabis permit and business license issued by the city will be posted inside of the facility in a location that is prominently visible to the public in accordance with FMC 9-3309(k). In compliance with FMC 9-3309(d), no cannabis or cannabis products or graphics depicting cannabis or cannabis products shall be visible from the exterior of Community Veterans of Fresno’s facility or delivery vehicles at any time. Location Street View Not only with Community Veterans of Fresno obtain a permit for all signage associated to the facility, but all of Community Veterans of Fresno’s facility advertisement and signage will adhere to the following guidelines and regulations pursuant to FMC 9-3309(h): • No signs placed on the premises will obstruct any entrance or exit to the building or any window. • Each entrance will be visibly posted with a clear and legible notice indicating that smoking, ingesting, or otherwise consuming cannabis or cannabis products on the premises or in the areas adjacent to the business is prohibited. • Business identification signage will be limited to that needed for identification only and will not contain any logos or information that identifies, advertises, or lists the services or the products offered. • Advertising will not be visible from the exterior of the establishment. • Community Veterans of Fresno will not advertise by having a person holding a sign and advertising the business to passersby, whether such person is on the premises or elsewhere including, but not limited to, the public right-of-way. • Signage will not be directly illuminated, internally or externally. • No banners, flags, billboards, or other prohibited signs may be used at any time. • Community Veterans of Fresno will not utilize a billboard (fixed or mobile), bus shelter, placard, aircraft, or other similar forms of advertising, anywhere in the state. Example of beautiful and tasteful business identification signage that will be affixed to the facility. Section: Location Subsection: Location Street View Applicant: Community Veterans of Fresno Page 166 of 200 Property Address: 3034 E. McKinley Ave. Fresno, CA 93703 6.2 LOCATION STREET VIEW 2159 India St. San Diego CA. 92101 info@heleo.co SET NOT FOR COUNSTRUCTION All Dimensions to be verified on site All ideas, designs and plans indicated or represented by these drawings are owned by and are property of Heleo Architecture and Design and were created and developed for use in connection with the specified project. None of such ideas, designs or plans shall be used for any purpose whatsoever without the written permission of Heleo © 2020 Heleo Architecture and Design. 12/3/2020 12:28:29 AM AERIAL VIEW MCKINLEY AVE CAKE A0113034 - 3072 E MCKINLEY AVE, FRESNO CA 93703 SITE LIGHTING RIDE SHARE AREA SOLAR CANOPY PROPOSED DISPENSRY DROUGHT TOLERANT LANDSCAPE EV CHARGING AREA HIGH ALBEDO ASPHALT COATING Cake Enterprises, Inc Community Veterans of Fresno, LLC. 1611 S. Melrose Drive, Ste. A #391, Vista, CA 92091 https://www.currntcannabis.com/ UPLOADED VIA CITY OF FRESNO PORTAL City of Fresno Cannabis Permitting Portal c/o Commercial Cannabis Business Permit https://fresnoca.viewpointcloud.com/ Re: Statement of Compliance that Application is True and Correct Fresno, California, Municipal Code Art. XXXIII, § 9-3316(d) (2020) To Whom It May Concern: I declare under penalty of perjury that the information contained within the foregoing Application by the Community Veterans of Fresno, LLC, for a commercial cannabis business permit is accurate and true to the best of the knowledge of its below authorized signatory. ((See Fresno, California, Municipal Code Art. XXXIII, § 9-3316(d)). This Statement of Compliance was executed on this 9th day of November 2020. COMMUNITY VETERANS OF FRESNO, LLC ________________________________________ By: Daniel Wise, President & CEO Its: Authorized Managing Manager, Cake Enterprises, Inc. danny@currntcannabis.com Community Veterans of Fresno, LLC d/b/a Cake 1611 S. Melrose Drive Suite A #391 Vista, CA 92091 Cake Enterprises, Inc Community Veterans of Fresno, LLC 1611 S. Melrose Drive, Ste. A #391, Vista, CA 92091 https://www.currntcannabis.com/ This Statement does not alter or amend any further requirement for Community Veterans of Fresno, LLC, to provide occupational safety and health training to employees. See Business and Professions Code 26051.5(11)(A) UPLOADED VIA CITY OF FRESNO PORTAL City of Fresno Cannabis Permitting Portal c/o Commercial Cannabis Business Permit https://fresnoca.viewpointcloud.com/ Re: Statement of Compliance with Cal-OSHA Training Fresno, California, Municipal Code Art. XXXIII, § 9-3316(c) (2020) To Whom It May Concern: Please allow this Statement to serve as confirmation that within one year of receiving a commercial cannabis business permit, Community Veterans of Fresno, LLC, shall ensure that at a minimum one supervisor and one employee will have successfully completed a Cal-OSHA 30-hour general industry outreach course offered by a training provider whom is authorized by an OSHA Training Institute Education Center to administer such course. ((See Fresno, California, Municipal Code Art. XXXIII, § 9-3316(c)). This Statement of Compliance was executed on this 9th day of November 2020. COMMUNITY VETERANS OF FRESNO, LLC ________________________________________ By: Daniel Wise, President & CEO Its: Authorized Managing Manager, Cake Enterprises, Inc. danny@currntcannabis.com Community Veterans of Fresno, LLC d/b/a Cake 1611 S. Melrose Drive Suite A #391 Vista, CA 92091